DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and Fbl6

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_610665.2 Gene:Fbl6 / 36201 FlyBaseID:FBgn0033609 Length:720 Species:Drosophila melanogaster


Alignment Length:474 Identity:105/474 - (22%)
Similarity:188/474 - (39%) Gaps:132/474 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 ASPESPPPVEGTHISNLFP-ELLEQIFEH-------LPVRDLGRAAQVCTAWRDAAYAKSVWKGV 192
            |:..:..|||.:..:...| |:|.:||||       ||.  |.|..:||:.||..:...::|:.:
  Fly   276 AAEAAGDPVEQSVWAQKLPEEVLFRIFEHAVDTQGCLPT--LFRLGRVCSLWRQVSLRPTLWRTM 338

  Fly   193 EAKLHLKRSSPSLFNCLVKRGIKKVQILSLRRSLKDLVLGVPALTSLNLSGCFNVADMNLGHA-F 256
            :....:|..        .:..:|....:..|.|         |.|.||:|. :.::|:|...| .
  Fly   339 DLTTWVKEK--------YRTELKLKWFVDNRCS---------ACTDLNVSN-WKISDINCFLAKL 385

  Fly   257 SVDLPNLKTLDLSLCKQITDTSLGRIAQHLRNLETLEL----------------GGCCNITNTGL 305
            |...|||..:.||..|..|...|..:..::..|:.|:|                ...||...|  
  Fly   386 SSGCPNLAGITLSGWKGFTSDHLTYLVDNMHKLQRLDLSSINVEMNASKSAVGVNSLCNALQT-- 448

  Fly   306 LLIAWGLKKLKHLNLRSCWHISDQGIGHLAGF-----------------SRETAEGNLQLEYLGL 353
                .| .:|.||.|.   |....||..:.|.                 ::.|:.|.|.:|.| .
  Fly   449 ----MG-SRLTHLYLA---HNRLAGIPQIVGILSTHCPNLTLLDLSNVTTQATSHGVLHIEKL-Q 504

  Fly   354 QDCQRLSDEAL--GHIAQGLTSLKSINLSFCVSVTDSGLKHLARMPKLEQLNLRSCDN----ISD 412
            :.||:|....:  .||.....|::.|        .||     ...|:||:|::.:..:    |||
  Fly   505 RGCQKLKVLRVTNSHITPSTASMQEI--------MDS-----PGFPELEELSVAALTDESRIISD 556

  Fly   413 IGMAYLTEGGSGINSLDVSFCDKISDQALTHIAQGLYRLRSLSLNQCQIT--------------D 463
            ..:..:.:..|.:..|||..|.:::.::|..:.  .:.::.|.|:.|.:|              .
  Fly   557 DHLQRILKSSSKLKLLDVRNCTRLTHESLIRLP--AWDIKHLFLSGCSVTRDMGSGLELIASKWA 619

  Fly   464 HGMLKI--------------AKALHE------LENLNIGQC-SRITDKGLQTLAEDLTNLKTIDL 507
            |.::::              .:||.|      |.:||:  | |.::|:.::.:..:..|:.:|:|
  Fly   620 HSLIELDLAWANMQQPIDNALRALAEKGRDSPLAHLNL--CGSSVSDEAVKEILTNCQNMSSINL 682

  Fly   508 YGCTQLSSKGIDIIMKLPK 526
            ..|..| .:|:..:|:.|:
  Fly   683 ASCRGL-PRGVKRLMQGPQ 700

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689 15/48 (31%)
AMN1 <226..>334 CDD:187754 31/124 (25%)
leucine-rich repeat 236..256 CDD:275381 7/20 (35%)
leucine-rich repeat 263..288 CDD:275381 6/24 (25%)
leucine-rich repeat 289..314 CDD:275381 7/40 (18%)
leucine-rich repeat 315..347 CDD:275381 10/48 (21%)
AMN1 347..524 CDD:187754 45/217 (21%)
leucine-rich repeat 348..373 CDD:275381 7/26 (27%)
leucine-rich repeat 374..398 CDD:275381 3/23 (13%)
leucine-rich repeat 399..424 CDD:275381 6/28 (21%)
leucine-rich repeat 425..450 CDD:275381 5/24 (21%)
leucine-rich repeat 451..475 CDD:275381 7/51 (14%)
leucine-rich repeat 476..501 CDD:275381 6/25 (24%)
Fbl6NP_610665.2 F-box-like 293..341 CDD:289689 16/49 (33%)
leucine-rich repeat 365..391 CDD:275381 8/26 (31%)
leucine-rich repeat 392..417 CDD:275381 6/24 (25%)
leucine-rich repeat 418..445 CDD:275381 4/26 (15%)
leucine-rich repeat 453..471 CDD:275381 7/20 (35%)
leucine-rich repeat 480..509 CDD:275381 6/29 (21%)
leucine-rich repeat 510..538 CDD:275381 7/40 (18%)
leucine-rich repeat 539..579 CDD:275381 11/39 (28%)
leucine-rich repeat 580..621 CDD:275381 5/42 (12%)
leucine-rich repeat 622..649 CDD:275381 3/26 (12%)
leucine-rich repeat 652..676 CDD:275381 6/25 (24%)
leucine-rich repeat 677..698 CDD:275381 6/21 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.