DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and H04D03.4

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001367066.1 Gene:H04D03.4 / 3565670 WormBaseID:WBGene00010365 Length:526 Species:Caenorhabditis elegans


Alignment Length:219 Identity:56/219 - (25%)
Similarity:89/219 - (40%) Gaps:44/219 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   339 RETAEGNLQLEYLG--LQDCQRLSDEALGHIAQG---------LTS------LKSINLS---FCV 383
            :|.|| |:| ||.|  |.| .|.||:....:.:.         ||.      ||.:||.   .||
 Worm    11 KEIAE-NIQ-EYKGNILLD-SRSSDQIFSQLLKTPDDQWSTRILTETTIKFHLKHVNLEGSWVCV 72

  Fly   384 SVTDSGLKHLARMPKLEQLNLRSCDNISDIGMAYLTEGGSGINSLDVSFC-----DKISDQALTH 443
            ...:...|.......:..:..|..|.|         |..||...:|:.|.     :|.:.:.|.|
 Worm    73 ETVNELQKQFLESFVIGSIQHRLRDEI---------EKESGNGKIDILFLLKKLFNKTTKKILRH 128

  Fly   444 IAQGLYRLRSLSLNQCQITDHGMLKIAKALHELENLNIGQCSRITDKGLQTLAEDLTNLKTIDLY 508
            :..|  ..|....|:..::|: :.:|::.|..|::|.:... ...|.....|..:..||..:|: 
 Worm   129 LDIG--NKRYFFDNRIFLSDN-LTRISQMLPSLQSLGVSNI-EFHDDDFSQLCNNFPNLTYLDI- 188

  Fly   509 GCTQLSSKGIDIIMKLPKLQKLNL 532
              ::.:.|.:|.|.||.||..|||
 Worm   189 --SETNIKSLDGISKLQKLYILNL 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689
AMN1 <226..>334 CDD:187754
leucine-rich repeat 236..256 CDD:275381
leucine-rich repeat 263..288 CDD:275381
leucine-rich repeat 289..314 CDD:275381
leucine-rich repeat 315..347 CDD:275381 4/7 (57%)
AMN1 347..524 CDD:187754 45/201 (22%)
leucine-rich repeat 348..373 CDD:275381 9/35 (26%)
leucine-rich repeat 374..398 CDD:275381 7/26 (27%)
leucine-rich repeat 399..424 CDD:275381 4/24 (17%)
leucine-rich repeat 425..450 CDD:275381 6/29 (21%)
leucine-rich repeat 451..475 CDD:275381 5/23 (22%)
leucine-rich repeat 476..501 CDD:275381 4/24 (17%)
H04D03.4NP_001367066.1 leucine-rich repeat 158..178 CDD:275380 4/20 (20%)
leucine-rich repeat 183..204 CDD:275380 7/23 (30%)
leucine-rich repeat 205..229 CDD:275380 4/6 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162686
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.