DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and CG32221

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_730456.2 Gene:CG32221 / 317924 FlyBaseID:FBgn0052221 Length:432 Species:Drosophila melanogaster


Alignment Length:410 Identity:89/410 - (21%)
Similarity:158/410 - (38%) Gaps:103/410 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 THISNLFPELLEQIFEHLPVRDLGRAAQVCTAWRDA-------AYAKSVWKGVEAKL-------- 196
            |.|.:|.|..|..||:.|.:.|....|:.|..:|||       .:...|.|.:..:.        
  Fly     5 TSILDLDPSSLLFIFKLLSLEDQLHLARCCRIFRDAFLRLHRHDFQDVVDKDMSIRTLEDWRTFL 69

  Fly   197 ----------------------------HLKR-SSPSLFNCLVKR---------GIKKVQILSLR 223
                                        |..| .|.|::|..|.|         .::||.:.:.:
  Fly    70 WLCGSRIGTLESHFDDDHPLQLLPMISRHCYRLKSISIYNATVARAQPYLLRMSSLEKVHVRNYK 134

  Fly   224 RSLKDLV--LGV--PALTSLNLSGCFNVADMNLGHAFSVDLPNLKTLDLSLCKQITDTSLGRIAQ 284
            .:.|||:  :|:  |.:.||:|.. |...::.....||      :.|:|.|...:|.:....|.:
  Fly   135 STSKDLIKAIGIHLPRVNSLSLES-FERKELQEVRQFS------EMLELGLYDDVTASEFATIVK 192

  Fly   285 HLRNLETLELGGCCN-ITNTGLLLIAWGLKKLKHLNLRSCWHISDQGIGHLAGF----------- 337
            .:|.|..|:|..... :|.:.|.::|...:.|:.|....|    |..:..|..|           
  Fly   193 PMRKLRCLQLRNAKRFLTTSNLRMLATNCRHLEKLTFNDC----DADLLVLPQFVNLKYLQLYCS 253

  Fly   338 ---------SRETAEGNLQLEYLGLQDCQRLSDEALGHIAQGLTSLKSINLSFCVSVTDSGLKHL 393
                     :...::.::|||||.|...:.:.:|.    ||.:::||.:....|....|..:.||
  Fly   254 EDMKTRLFKALAKSQCSIQLEYLILHRKRWIDEEQ----AQYISALKCLRWLVCKPRDDLCVHHL 314

  Fly   394 ARMPKLEQLNLRSCDNISDIGMAYLTEGGSGINSLDVSFCDKISDQALTHIAQGLYRLRSLSLNQ 458
            |::.:||.|:::|...|.:..::.|......:..|::.:|..|:|      |..|..|.|||...
  Fly   315 AKLSRLECLSIQSAREIGETQLSLLVANNERLRYLNICYCLGITD------AFVLDTLASLSKRS 373

  Fly   459 CQITDHGMLKIAKALHELEN 478
            .    |..|::..|..::.:
  Fly   374 A----HQTLELFAAATDIRH 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689 14/47 (30%)
AMN1 <226..>334 CDD:187754 27/112 (24%)
leucine-rich repeat 236..256 CDD:275381 4/19 (21%)
leucine-rich repeat 263..288 CDD:275381 5/24 (21%)
leucine-rich repeat 289..314 CDD:275381 6/25 (24%)
leucine-rich repeat 315..347 CDD:275381 6/51 (12%)
AMN1 347..524 CDD:187754 35/132 (27%)
leucine-rich repeat 348..373 CDD:275381 8/24 (33%)
leucine-rich repeat 374..398 CDD:275381 7/23 (30%)
leucine-rich repeat 399..424 CDD:275381 6/24 (25%)
leucine-rich repeat 425..450 CDD:275381 6/24 (25%)
leucine-rich repeat 451..475 CDD:275381 7/23 (30%)
leucine-rich repeat 476..501 CDD:275381 0/3 (0%)
CG32221NP_730456.2 leucine-rich repeat 197..223 CDD:275381 6/25 (24%)
leucine-rich repeat 224..244 CDD:275381 6/23 (26%)
leucine-rich repeat 245..272 CDD:275381 0/26 (0%)
leucine-rich repeat 273..297 CDD:275381 9/27 (33%)
leucine-rich repeat 298..319 CDD:275381 5/20 (25%)
leucine-rich repeat 320..345 CDD:275381 6/24 (25%)
leucine-rich repeat 346..372 CDD:275381 10/31 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.