DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and Fbxl4

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001382505.1 Gene:Fbxl4 / 313101 RGDID:1305724 Length:621 Species:Rattus norvegicus


Alignment Length:340 Identity:91/340 - (26%)
Similarity:137/340 - (40%) Gaps:69/340 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 ELLEQIFEHLPVRDLGRAAQVC---------------------------------------TAWR 180
            ||::.|..||.:.||.|.||.|                                       ..|.
  Rat   286 ELIQLILNHLSLPDLCRLAQTCRLLHQHCCDPLQYIHLNLQPYWAKLDDTSLEFLQARCALVQWL 350

  Fly   181 DAAYAKSVWKGVEAKLHLKRSSPSLFNCLVKRGIKKVQI-LSLRRSLKDLVLGV-----PALTSL 239
            :.:     |.|....:.:...|..|..|    |.:.|:: ||....|.|..|.|     |.|..|
  Rat   351 NLS-----WTGNRGFISVSGFSRFLKVC----GSE
LVRLELSCSHFLNDACLEVISEMCPNLQDL 406

  Fly   240 NLSGCFNVADMNLGHAFSVDLPNLKTLDLSLCKQITDTSLGRIAQHLRNLETLELGGCCNITNTG 304
            |||.|..:.....||.  ..|.:||.|.|...| :..|:|..|......|:.|.||.|..|.:..
  Rat   407 NLSSCDKLPPQAFGHI--AKLRSLKRLILYRTK-VEQTALLSILNFCAELQHLSLGSCVMIEDYD 468

  Fly   305 LL--LIAWGLKKLKHLNLRSCWHISDQGIGHLAGFSRETAEGNLQLEYLGLQDCQRL--SDEALG 365
            ::  :|....|.|:.|:|..|.:|::.||.       |.|.|...||.|.|..|..|  |.....
  Rat   469 VIASMIGAKCKSLRTLDLWRCKNITENGIA-------ELASGCALLEELDLGWCPTLQSSTGCFA 526

  Fly   366 HIAQGLTSLKSINLSFCVSVTDSGLKHLA-RMPKLEQLNLRSCDNISDIGMAYLTEGGSGINSLD 429
            .:|:.|.:|:.:.|:...||.|:.::.|| ...:|:||::.....:|...:..|.|....::.||
  Rat   527 RLARQLPNLQKLFLTANRSVCDTDIEELASNCTRLQQLDILGTRMVSPASLRKLLESCKDLSLLD 591

  Fly   430 VSFCDKISDQALTHI 444
            ||||.:|.::|:..:
  Rat   592 VSFCSQIDNRAVLEL 606

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689 12/73 (16%)
AMN1 <226..>334 CDD:187754 37/114 (32%)
leucine-rich repeat 236..256 CDD:275381 8/19 (42%)
leucine-rich repeat 263..288 CDD:275381 8/24 (33%)
leucine-rich repeat 289..314 CDD:275381 7/26 (27%)
leucine-rich repeat 315..347 CDD:275381 10/31 (32%)
AMN1 347..524 CDD:187754 30/101 (30%)
leucine-rich repeat 348..373 CDD:275381 9/26 (35%)
leucine-rich repeat 374..398 CDD:275381 7/24 (29%)
leucine-rich repeat 399..424 CDD:275381 6/24 (25%)
leucine-rich repeat 425..450 CDD:275381 8/20 (40%)
leucine-rich repeat 451..475 CDD:275381
leucine-rich repeat 476..501 CDD:275381
Fbxl4NP_001382505.1 F-box-like 280..318 CDD:403981 11/31 (35%)
leucine-rich repeat 295..317 CDD:275381 7/21 (33%)
leucine-rich repeat 318..340 CDD:275381 0/21 (0%)
leucine-rich repeat 347..376 CDD:275381 7/37 (19%)
leucine-rich repeat 377..402 CDD:275381 7/24 (29%)
AMN1 394..601 CDD:187754 66/216 (31%)
leucine-rich repeat 403..427 CDD:275381 9/25 (36%)
leucine-rich repeat 428..452 CDD:275381 8/24 (33%)
leucine-rich repeat 453..480 CDD:275381 7/26 (27%)
leucine-rich repeat 481..506 CDD:275381 10/31 (32%)
leucine-rich repeat 507..534 CDD:275381 9/26 (35%)
leucine-rich repeat 535..560 CDD:275381 7/24 (29%)
leucine-rich repeat 561..586 CDD:275381 6/24 (25%)
leucine-rich repeat 587..612 CDD:275381 8/20 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.