DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and Fbxl14

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001258205.1 Gene:Fbxl14 / 312675 RGDID:1305523 Length:400 Species:Rattus norvegicus


Alignment Length:389 Identity:246/389 - (63%)
Similarity:307/389 - (78%) Gaps:0/389 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 THISNLFPELLEQIFEHLPVRDLGRAAQVCTAWRDAAYAKSVWKGVEAKLHLKRSSPSLFNCLVK 211
            ||||.||||||..||.:|.|||.|||||||||||||||.||||:||||||||:|::||||..|..
  Rat     3 THISCLFPELLAMIFGYLDVRDKGRAAQVCTAWRDAAYHKSVWRGVEAKLHLRRANPSLFPSLQA 67

  Fly   212 RGIKKVQILSLRRSLKDLVLGVPALTSLNLSGCFNVADMNLGHAFSVDLPNLKTLDLSLCKQITD 276
            |||::||||||||||..::.|:..:.|||||||:|:.|..|||||..::.:|:.|:|||||||||
  Rat    68 RGIRRVQILSLRRSLSYVIQGMANIESLNLSGCYNLTDNGLGHAFVQEIGSLRALNLSLCKQITD 132

  Fly   277 TSLGRIAQHLRNLETLELGGCCNITNTGLLLIAWGLKKLKHLNLRSCWHISDQGIGHLAGFSRET 341
            :|||||||:|:.||.||||||.||||||||||||||::||.||||||.|:||.|||||||.:|..
  Rat   133 SSLGRIAQYLKGLEVLELGGCSNITNTGLLLIAWGLQRLKSLNLRSCRHLSDVGIGHLAGMTRSA 197

  Fly   342 AEGNLQLEYLGLQDCQRLSDEALGHIAQGLTSLKSINLSFCVSVTDSGLKHLARMPKLEQLNLRS 406
            |||.|.||.|.|||||:|:|.:|.||::|||.|:.:|||||..::|:||.||:.|..|..|||||
  Rat   198 AEGCLGLEQLTLQDCQKLTDLSLKHISRGLTGLRLLNLSFCGGISDAGLLHLSHMGSLRSLNLRS 262

  Fly   407 CDNISDIGMAYLTEGGSGINSLDVSFCDKISDQALTHIAQGLYRLRSLSLNQCQITDHGMLKIAK 471
            ||||||.|:.:|..|...::.||||||||:.||:|.:|||||..|:||||..|.|:|.|:.::.:
  Rat   263 CDNISDTGIMHLAMGSLRLSGLDVSFCDKVGDQSLAYIAQGLDGLKSLSLCSCHISDDGINRMVR 327

  Fly   472 ALHELENLNIGQCSRITDKGLQTLAEDLTNLKTIDLYGCTQLSSKGIDIIMKLPKLQKLNLGLW 535
            .:|.|..||||||.|||||||:.:||.|:.|..|||||||:::.:|::.|.:||.|:.||||||
  Rat   328 QMHGLRTLNIGQCVRITDKGLELIAEHLSQLTGIDLYGCTRITKRGLERITQLPCLKVLNLGLW 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689 32/40 (80%)
AMN1 <226..>334 CDD:187754 71/107 (66%)
leucine-rich repeat 236..256 CDD:275381 12/19 (63%)
leucine-rich repeat 263..288 CDD:275381 19/24 (79%)
leucine-rich repeat 289..314 CDD:275381 22/24 (92%)
leucine-rich repeat 315..347 CDD:275381 22/31 (71%)
AMN1 347..524 CDD:187754 96/176 (55%)
leucine-rich repeat 348..373 CDD:275381 15/24 (63%)
leucine-rich repeat 374..398 CDD:275381 12/23 (52%)
leucine-rich repeat 399..424 CDD:275381 15/24 (63%)
leucine-rich repeat 425..450 CDD:275381 16/24 (67%)
leucine-rich repeat 451..475 CDD:275381 9/23 (39%)
leucine-rich repeat 476..501 CDD:275381 17/24 (71%)
Fbxl14NP_001258205.1 F-box-like 5..46 CDD:403981 32/40 (80%)
AMN1 90..296 CDD:187754 130/205 (63%)
leucine-rich repeat 92..118 CDD:275381 14/25 (56%)
leucine-rich repeat 119..142 CDD:275381 18/22 (82%)
leucine-rich repeat 145..170 CDD:275381 22/24 (92%)
leucine-rich repeat 171..203 CDD:275381 22/31 (71%)
leucine-rich repeat 204..229 CDD:275381 15/24 (63%)
AMN1 228..395 CDD:187754 90/164 (55%)
leucine-rich repeat 230..254 CDD:275381 12/23 (52%)
leucine-rich repeat 255..280 CDD:275381 15/24 (63%)
leucine-rich repeat 281..306 CDD:275381 16/24 (67%)
leucine-rich repeat 307..331 CDD:275381 9/23 (39%)
leucine-rich repeat 332..357 CDD:275381 17/24 (71%)
leucine-rich repeat 358..382 CDD:275381 11/23 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H15271
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1282076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.