Sequence 1: | NP_001261138.1 | Gene: | Ppa / 37602 | FlyBaseID: | FBgn0020257 | Length: | 562 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001101073.1 | Gene: | Fbxl15 / 309453 | RGDID: | 1306444 | Length: | 300 | Species: | Rattus norvegicus |
Alignment Length: | 259 | Identity: | 71/259 - (27%) |
---|---|---|---|
Similarity: | 121/259 - (46%) | Gaps: | 47/259 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 286 LRNLETLELGGCCNITNTGLLLIAWGLKKLKHLNLRSC--WHISDQGIGHLAGFSRETAEGNLQL 348
Fly 349 EYLGLQDCQRLSDEALGHIAQGLTSLKSINLSFCVSVTDSGLKHLA-RMPKLEQLNLRSCDNISD 412
Fly 413 IGMAYLTE-GGSGINSLDVSFCDKISDQALTHIAQGLYRLRSLSLNQCQITDHGMLKIAKALHEL 476
Fly 477 ENLNIGQCSRITDKGLQTLAEDLTNLKTIDLYGC--------TQLSSKGIDIIMKLPKLQKLNL 532 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ppa | NP_001261138.1 | F-box-like | 149..190 | CDD:289689 | |
AMN1 | <226..>334 | CDD:187754 | 10/49 (20%) | ||
leucine-rich repeat | 236..256 | CDD:275381 | |||
leucine-rich repeat | 263..288 | CDD:275381 | 1/1 (100%) | ||
leucine-rich repeat | 289..314 | CDD:275381 | 3/24 (13%) | ||
leucine-rich repeat | 315..347 | CDD:275381 | 8/33 (24%) | ||
AMN1 | 347..524 | CDD:187754 | 54/186 (29%) | ||
leucine-rich repeat | 348..373 | CDD:275381 | 10/24 (42%) | ||
leucine-rich repeat | 374..398 | CDD:275381 | 9/24 (38%) | ||
leucine-rich repeat | 399..424 | CDD:275381 | 9/25 (36%) | ||
leucine-rich repeat | 425..450 | CDD:275381 | 2/24 (8%) | ||
leucine-rich repeat | 451..475 | CDD:275381 | 5/23 (22%) | ||
leucine-rich repeat | 476..501 | CDD:275381 | 10/24 (42%) | ||
Fbxl15 | NP_001101073.1 | F-box | 18..55 | CDD:395521 | |
leucine-rich repeat | 62..88 | CDD:275381 | 5/27 (19%) | ||
leucine-rich repeat | 89..115 | CDD:275381 | 8/33 (24%) | ||
Interaction with SMURF1. /evidence=ECO:0000250 | 113..269 | 52/180 (29%) | |||
leucine-rich repeat | 116..141 | CDD:275381 | 10/24 (42%) | ||
AMN1 | <139..>268 | CDD:187754 | 40/153 (26%) | ||
leucine-rich repeat | 142..167 | CDD:275381 | 9/24 (38%) | ||
leucine-rich repeat | 168..194 | CDD:275381 | 9/25 (36%) | ||
leucine-rich repeat | 195..220 | CDD:275381 | 7/49 (14%) | ||
leucine-rich repeat | 221..245 | CDD:275381 | 10/23 (43%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |