DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and Fbxl19

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:XP_006230338.1 Gene:Fbxl19 / 308999 RGDID:1310989 Length:739 Species:Rattus norvegicus


Alignment Length:339 Identity:85/339 - (25%)
Similarity:129/339 - (38%) Gaps:94/339 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 PHRPASPESPPPVEGTHISNLFPELLE--------------------QIFEHLPVRDLGRAAQVC 176
            |..||.|..||.:| .|:....|...|                    ::|:||..|:|....:||
  Rat   430 PLGPAPPPRPPQLE-RHVVRPPPRSPEPDTLPLAAGSDHPLPRAAWLRVFQHLGPRELCVCMRVC 493

  Fly   177 TAWRDAAYAKSVWKGVEAKLHLKRSSPSLFNCLVKR----------GIKKVQILSLRRSLKDLVL 231
            ..|....|.|.:|..::.. ..|..:|.:.:.:|:|          |:.|.|::.|...|:    
  Rat   494 RTWSRWCYDKRLWPRMDLS-RRKSLTPPMLSGVVRRQPRALDLSWTGVSKKQLMWLLNRLQ---- 553

  Fly   232 GVPALTSLNLSGCFNVADMNLGHAFSVDLPNLKTLDLSLCKQITDTSL----------------- 279
               .|..|.||||..::...||   |..||.|:.|||...:.:.|:.|                 
  Rat   554 ---GLQELVLSGCSWLSVSALG---SAPLPALRLLDLRWIEDVKDSQLRELLLPPPDTKPGQTES 612

  Fly   280 -GRIAQHLRNLETLELGGCCNITNTGLLLIAWGLKKLKHLNLRSCWHISDQGIGHLAGFSRETAE 343
             ||    |:.:..|.|.| ..:|:..|.|:.....:|..|:|..|.|:.|..: ||  .:..|:.
  Rat   613 RGR----LQGVAELRLAG-LELTDASLRLLLRHAPQLSALDLSHCAHVGDPSV-HL--LTAPTSP 669

  Fly   344 GNLQLEYLGLQDCQRLSDEALGHIAQGLTSLKSINLSFCVSVTDSGLKHLARMPKLEQLNLRSCD 408
            ....|.:|.|..|.||:|.                   |:.:       ..|.|:|.:|:||||.
  Rat   670 LRETLVHLNLAGCHRLTDH-------------------CLPL-------FRRCPRLRRLDLRSCR 708

  Fly   409 NISDIGMAYLTEGG 422
            .:|....|.|...|
  Rat   709 QLSPEACARLAAAG 722

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689 12/60 (20%)
AMN1 <226..>334 CDD:187754 33/125 (26%)
leucine-rich repeat 236..256 CDD:275381 8/19 (42%)
leucine-rich repeat 263..288 CDD:275381 9/42 (21%)
leucine-rich repeat 289..314 CDD:275381 6/24 (25%)
leucine-rich repeat 315..347 CDD:275381 9/31 (29%)
AMN1 347..524 CDD:187754 20/76 (26%)
leucine-rich repeat 348..373 CDD:275381 7/24 (29%)
leucine-rich repeat 374..398 CDD:275381 2/23 (9%)
leucine-rich repeat 399..424 CDD:275381 10/24 (42%)
leucine-rich repeat 425..450 CDD:275381
leucine-rich repeat 451..475 CDD:275381
leucine-rich repeat 476..501 CDD:275381
Fbxl19XP_006230338.1 zf-CXXC <95..122 CDD:251032
PHD_FXL19 132..193 CDD:277115
F-box-like 469..512 CDD:289689 11/42 (26%)
AMN1 511..710 CDD:187754 60/243 (25%)
leucine-rich repeat 531..554 CDD:275381 5/29 (17%)
leucine-rich repeat 555..578 CDD:275381 10/25 (40%)
leucine-rich repeat 616..643 CDD:275381 7/27 (26%)
leucine-rich repeat 644..670 CDD:275381 9/28 (32%)
leucine-rich repeat 674..698 CDD:275381 9/49 (18%)
leucine-rich repeat 699..723 CDD:275381 10/24 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.