Sequence 1: | NP_001261138.1 | Gene: | Ppa / 37602 | FlyBaseID: | FBgn0020257 | Length: | 562 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001273458.1 | Gene: | Fbxl12 / 30843 | MGIID: | 1354738 | Length: | 349 | Species: | Mus musculus |
Alignment Length: | 272 | Identity: | 66/272 - (24%) |
---|---|---|---|
Similarity: | 105/272 - (38%) | Gaps: | 86/272 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 174 QVCTAWRDAAYAKSVWKGVEAKLHLKRSSPSLFNCLVKRGIKKVQILSLRRS------------- 225
Fly 226 ---LKDLVLGVPALTSLNLSGCFNVADMNLGHAFSVDLPN-LKTLDLSLC--------KQITDTS 278
Fly 279 LGRIA------------QHL------RNLETLELGGCCNITNTGLLLIAWGLKKLKHLNLRSCWH 325
Fly 326 ISDQGIGHLAGFSRETAEGNLQLEYLGLQDCQRLSDEALGHIAQGLTSLKSINLSFCVSVTDSGL 390
Fly 391 KHLARMPKLEQL 402 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ppa | NP_001261138.1 | F-box-like | 149..190 | CDD:289689 | 3/15 (20%) |
AMN1 | <226..>334 | CDD:187754 | 34/134 (25%) | ||
leucine-rich repeat | 236..256 | CDD:275381 | 6/19 (32%) | ||
leucine-rich repeat | 263..288 | CDD:275381 | 10/50 (20%) | ||
leucine-rich repeat | 289..314 | CDD:275381 | 10/24 (42%) | ||
leucine-rich repeat | 315..347 | CDD:275381 | 2/31 (6%) | ||
AMN1 | 347..524 | CDD:187754 | 19/56 (34%) | ||
leucine-rich repeat | 348..373 | CDD:275381 | 9/24 (38%) | ||
leucine-rich repeat | 374..398 | CDD:275381 | 6/23 (26%) | ||
leucine-rich repeat | 399..424 | CDD:275381 | 3/4 (75%) | ||
leucine-rich repeat | 425..450 | CDD:275381 | |||
leucine-rich repeat | 451..475 | CDD:275381 | |||
leucine-rich repeat | 476..501 | CDD:275381 | |||
Fbxl12 | NP_001273458.1 | F-box-like | <51..73 | CDD:289689 | 5/20 (25%) |
leucine-rich repeat | 127..148 | CDD:275381 | 9/26 (35%) | ||
AMN1 | 144..>249 | CDD:187754 | 34/139 (24%) | ||
leucine-rich repeat | 149..175 | CDD:275381 | 8/25 (32%) | ||
leucine-rich repeat | 176..200 | CDD:275381 | 2/23 (9%) | ||
leucine-rich repeat | 201..226 | CDD:275381 | 11/27 (41%) | ||
leucine-rich repeat | 227..252 | CDD:275381 | 10/54 (19%) | ||
leucine-rich repeat | 253..276 | CDD:275381 | 6/23 (26%) | ||
leucine-rich repeat | 277..306 | CDD:275381 | 3/4 (75%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |