DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and Kdm2b

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:XP_011246510.1 Gene:Kdm2b / 30841 MGIID:1354737 Length:1312 Species:Mus musculus


Alignment Length:359 Identity:94/359 - (26%)
Similarity:139/359 - (38%) Gaps:82/359 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 LRFTPYALHH------RPPHHQLQTLPPALYLQHAAAAAAAAAAAAAHAQHHHHHHHHLPHRPAS 137
            |..||..|.|      |.|...:...||           :|:.......:.|       ..|| .
Mouse   977 LNGTPRELRHSLGPGLRSPPRVMSRPPP-----------SASPPKCIQMERH-------VIRP-P 1022

  Fly   138 PESPPPVE------GTHISNLFPELLEQIFEHLPVRDLGRAAQVCTAWRDAAYAKSVWKGVEAKL 196
            |.||||..      ..|:  :..|:...:|.:|..|||....:||..|......|.:|..::.. 
Mouse  1023 PISPPPDSLPLDDGAAHV--MHREVWMAVFSYLSHRDLCVCMRVCRTWNRWCCDKRLWTRIDLN- 1084

  Fly   197 HLKRSSPSLFNCLVKRGIKKVQILSL--------RRSLKDLVLGVPALTSLNLSGCFNVADMNLG 253
            ..|..:|.:.:.:::|     |.:||        ::.|..|:..:|.|..|.||||..:|   :.
Mouse  1085 RCKSITPLMLSGIIRR-----QPVSLDLSWTNISKKQLSWLINRLPGLRDLVLSGCSWIA---VS 1141

  Fly   254 HAFSVDLPNLKTLDL------------SLCKQITDTSLGRI--AQHLRNLETLELGGCCNITNTG 304
            ...|...|.|:|||:            .|....||...|::  ...|||:..|.|.| .:||:..
Mouse  1142 ALCSSSCPLLRTLDVQWVEGLKDAQMRDLLSPPTDNRPGQMDNRSKLRNIVELRLAG-LDITDVS 1205

  Fly   305 LLLIAWGLKKLKHLNLRSCWHISDQGIGHLAGFSRETAEGNLQLEYLGLQDCQRLSDEAL----- 364
            |.||...:..|..|.|..|.||:||.|..|......|.:   .|..:.|.||.:::|..|     
Mouse  1206 LRLIIRHMPLLSKLQLSYCNHINDQSINLLTAVGTTTRD---SLTEVNLSDCNKVTDLCLSFFKR 1267

  Fly   365 -GHIAQGLTSLKSINLSFCVSVTDSGLKH-LARM 396
             |:|..       |:|.:|..||..|.:. :|.|
Mouse  1268 CGNICH-------IDLRYCKQVTKEGCEQFIAEM 1294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689 10/40 (25%)
AMN1 <226..>334 CDD:187754 40/121 (33%)
leucine-rich repeat 236..256 CDD:275381 7/19 (37%)
leucine-rich repeat 263..288 CDD:275381 9/38 (24%)
leucine-rich repeat 289..314 CDD:275381 8/24 (33%)
leucine-rich repeat 315..347 CDD:275381 11/31 (35%)
AMN1 347..524 CDD:187754 16/57 (28%)
leucine-rich repeat 348..373 CDD:275381 8/30 (27%)
leucine-rich repeat 374..398 CDD:275381 8/24 (33%)
leucine-rich repeat 399..424 CDD:275381
leucine-rich repeat 425..450 CDD:275381
leucine-rich repeat 451..475 CDD:275381
leucine-rich repeat 476..501 CDD:275381
Kdm2bXP_011246510.1 JmjC 151..226 CDD:214721
cupin_like 198..297 CDD:389752
JHD 303..>338 CDD:375347
zf-CXXC <588..624 CDD:366873
PHD_KDM2B 634..695 CDD:277114
PTZ00449 <693..995 CDD:185628 6/17 (35%)
F-box-like 1044..1082 CDD:372399 11/37 (30%)
leucine-rich repeat 1053..1075 CDD:275381 7/21 (33%)
leucine-rich repeat 1078..1102 CDD:275381 4/29 (14%)
AMN1 1083..1283 CDD:187754 59/219 (27%)
leucine-rich repeat 1103..1126 CDD:275381 4/22 (18%)
leucine-rich repeat 1127..1150 CDD:275381 8/25 (32%)
leucine-rich repeat 1151..1190 CDD:275381 9/38 (24%)
leucine-rich repeat 1191..1215 CDD:275381 8/24 (33%)
leucine-rich repeat 1216..1245 CDD:275381 11/31 (35%)
leucine-rich repeat 1246..1270 CDD:275381 6/23 (26%)
leucine-rich repeat 1271..1295 CDD:275381 9/31 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.