DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and Fbxl21

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:XP_038951543.1 Gene:Fbxl21 / 306750 RGDID:1305555 Length:460 Species:Rattus norvegicus


Alignment Length:437 Identity:99/437 - (22%)
Similarity:162/437 - (37%) Gaps:116/437 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 ASPESPPPVEGTHIS----NLFPELLE----------QIFEHLPVRDLGRAAQVCTAWRDAAYAK 186
            :||....|..|...|    .:...||:          :||::||:.|..||:.||.:|.:..:..
  Rat    41 SSPAVKQPKRGLCTSLRQTQMLSALLDWGTLPHHVILRIFQYLPLVDRARASSVCRSWNEVFHIP 105

  Fly   187 SVWKGVEAKL------HLKRSSPSLFNCLVKRGIKKVQILSLR------------RSLKDLV--- 230
            .:|:..|.:|      :.|.:.|.|...::|:....:|.:|.:            ..|..||   
  Rat   106 DLWRKFEFELNQSATSYFKSTHPDLIQQIIKKHAAHLQYVSFKVDSSTESAEAACHILSQLVNCS 170

  Fly   231 ---LGVPALTSLNLSGCFNVADMNLGHAFSVDLPNLKTLDLSLCKQITDTSLGRIAQHLRNLETL 292
               ||   |.|.......|:...:...|.:|...|.|:|. |:  :|.||.              
  Rat   171 IQTLG---LISTAKPSFMNMPKSHFVSALTVVFVNSKSLS-SI--KIEDTP-------------- 215

  Fly   293 ELGGCCNITNTGL-LLIAWGLKKLKHLNLRSCWHISDQGI----GHLAGFSRETAEGNLQLEYLG 352
                   :.:..| :|:|.....|:.|.:.||.|:|..||    .|..|. ||     |.|.|  
  Rat   216 -------VDDPSLKILVANNSDTLRLLKMSSCPHVSSDGILCVADHCQGL-RE-----LALNY-- 265

  Fly   353 LQDCQRLSDEALGHIAQGLTSLKSINLSF----CVSVTDSGLK-HLARMPKLEQLNLRSCDNISD 412
                ..||||.|    ..|:|...:||..    .||.....:| |..:.|..:.| ::....::.
  Rat   266 ----YILSDELL----LALSSETHVNLEHLRIDVVSENPGQIKFHSIKKPSWDAL-VKHSPGVNV 321

  Fly   413 IGMAYLTEGGSGINSLDVSFCDKISDQALTHIAQGLYRLRSLS---LNQCQITDHGMLKIAKALH 474
            :...:|.|     ...|..|.:   :..:||    ||..||:|   |.:..:....::::....:
  Rat   322 VMYFFLYE-----EEFDTFFKE---ETPVTH----LYFGRSVSRTILGRIGLNCPRLIELVVCAN 374

  Fly   475 ELENLNIGQCSRITDKGLQTLAEDLTNLKTIDLYGCTQLSSKGIDII 521
            .|:.|         |..|..:||...||..:.|..|....|..::.:
  Rat   375 GLQPL---------DSELIRIAEHCKNLTALGLSECEVSCSAFVEFV 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689 13/54 (24%)
AMN1 <226..>334 CDD:187754 28/118 (24%)
leucine-rich repeat 236..256 CDD:275381 3/19 (16%)
leucine-rich repeat 263..288 CDD:275381 6/24 (25%)
leucine-rich repeat 289..314 CDD:275381 3/25 (12%)
leucine-rich repeat 315..347 CDD:275381 12/35 (34%)
AMN1 347..524 CDD:187754 40/183 (22%)
leucine-rich repeat 348..373 CDD:275381 8/24 (33%)
leucine-rich repeat 374..398 CDD:275381 6/28 (21%)
leucine-rich repeat 399..424 CDD:275381 3/24 (13%)
leucine-rich repeat 425..450 CDD:275381 5/24 (21%)
leucine-rich repeat 451..475 CDD:275381 4/26 (15%)
leucine-rich repeat 476..501 CDD:275381 6/24 (25%)
Fbxl21XP_038951543.1 F-box-like 68..111 CDD:403981 11/42 (26%)
leucine-rich repeat 206..231 CDD:275381 8/48 (17%)
leucine-rich repeat 232..257 CDD:275381 9/24 (38%)
leucine-rich repeat 258..283 CDD:275381 12/40 (30%)
leucine-rich repeat 284..318 CDD:275381 7/34 (21%)
leucine-rich repeat 329..365 CDD:275381 11/47 (23%)
AMN1 <359..>424 CDD:187754 11/63 (17%)
leucine-rich repeat 366..392 CDD:275381 6/34 (18%)
leucine-rich repeat 393..418 CDD:275381 4/20 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.