DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and Fbxl3

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001094038.1 Gene:Fbxl3 / 306129 RGDID:1305660 Length:428 Species:Rattus norvegicus


Alignment Length:402 Identity:89/402 - (22%)
Similarity:156/402 - (38%) Gaps:108/402 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 ESPPPVEGTH-------ISNLFPELLEQIFEHLPVRDLGRAAQVCTAWRDAAYAKSVWKGVEAKL 196
            |.|.....||       ..||..:::..:|::||:.|...|:|||..|....:...:|:..|.:|
  Rat    19 EKPKKPRTTHECSQPCDWGNLLQDIVLHVFKYLPLLDRAHASQVCRNWNQVFHMPDLWRCFEFEL 83

  Fly   197 ------HLKRSSPSLFNCLVKRGIKKVQILSLR-RSLKDL------VLGVPALTSLNLSGCFNVA 248
                  :||.:.|.|...::||....:|.:|.: .|.|:.      :|......||...|..:.|
  Rat    84 NQPATSYLKATHPELIKQIIKRHSNHLQYVSFKVDSSKESAEAACDILSQLVNCSLKTLGLISTA 148

  Fly   249 -----DMNLGH---AFSVDLPNLKTLDLSLCKQITDTSLG------RIAQHLRNLETLELGGCCN 299
                 |:...|   |.:|...|.|:|. ||  :|.||.:.      .:|.:...|:.|::..|.:
  Rat   149 RPSFMDLPKSHFISALTVVFVNSKSLS-SL--KIDDTPVDDPSLKVLVANNSDTLKLLKMSSCPH 210

  Fly   300 ITNTGLLLIAWGLKKLKHLNLRSCWH-ISDQGIGHLAGFSRETAEGNLQLEYLGLQDCQRLSDEA 363
            ::..|:|.:|.....|:.|.|.  :| :||:.:..|      ::|.:::||:|.:........:.
  Rat   211 VSPAGILCVADQCHGLRELALN--YHLLSDELLLAL------SSEKHVRLEHLRIDVVSENPGQT 267

  Fly   364 LGHIAQGLTSLKSINLSFCVSVTDSGLKHLARMPKLEQLNL------------------------ 404
            ..|..|             .|..|:.:||   .||   :||                        
  Rat   268 HFHTIQ-------------KSSWDAFIKH---SPK---VNLVMYFFLYEEEFDPFFRYEIPATHL 313

  Fly   405 ---RSC--DNISDIGM-----AYLTEGGSGINSLDVSFCDKISDQALTHIAQGLYRLRSLSLNQC 459
               ||.  |.:..:||     ..|....:|:..|         |:.|..||:....|.::.|.:|
  Rat   314 YFGRSVSKDVLGRVGMTCPRLVELVVCANGLRPL---------DEELIRIAERCKNLSAIGLGEC 369

  Fly   460 QITDHGMLKIAK 471
            :::....::..|
  Rat   370 EVSCSAFVEFVK 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689 11/40 (28%)
AMN1 <226..>334 CDD:187754 31/128 (24%)
leucine-rich repeat 236..256 CDD:275381 6/27 (22%)
leucine-rich repeat 263..288 CDD:275381 8/30 (27%)
leucine-rich repeat 289..314 CDD:275381 6/24 (25%)
leucine-rich repeat 315..347 CDD:275381 8/32 (25%)
AMN1 347..524 CDD:187754 29/159 (18%)
leucine-rich repeat 348..373 CDD:275381 5/24 (21%)
leucine-rich repeat 374..398 CDD:275381 4/23 (17%)
leucine-rich repeat 399..424 CDD:275381 8/58 (14%)
leucine-rich repeat 425..450 CDD:275381 5/24 (21%)
leucine-rich repeat 451..475 CDD:275381 4/21 (19%)
leucine-rich repeat 476..501 CDD:275381
Fbxl3NP_001094038.1 F-box-like 36..77 CDD:403981 11/40 (28%)
leucine-rich repeat 174..199 CDD:275381 7/27 (26%)
leucine-rich repeat 200..225 CDD:275381 6/24 (25%)
leucine-rich repeat 252..286 CDD:275381 9/49 (18%)
leucine-rich repeat 287..333 CDD:275381 7/45 (16%)
leucine-rich repeat 334..360 CDD:275381 7/34 (21%)
leucine-rich repeat 361..383 CDD:275381 4/21 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.