DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Ppa and FBXL22

DIOPT Version :9

Sequence 1:	NP_001261138.1	Gene:	Ppa / 37602	FlyBaseID:	FBgn0020257	Length:	562	Species:	Drosophila melanogaster
Sequence 2:	XP_011519770.1	Gene:	FBXL22 / 283807	HGNCID:	27537	Length:	260	Species:	Homo sapiens

Alignment Length:	82	Identity:	29/82 - (35%)
Similarity:	42/82 - (51%)	Gaps:	8/82 - (9%)

- Green bases have known domain annotations that are detailed below.

  Fly   373 SLKSINLSFCVSVTDSGLKHLAR-MPKLEQLNLRSCDNISDIGMAYLTEGGSGINSLDVSFCDKI 436
            :|.|:.||.|..|||..|..|.| .|:|..|.|.:|..:::..:|.:...|..:.:|.|.||..:
Human   150 NLASVTLSGCGHVTDDCLARLLRCCPRLRALRLENCARVTNRTLAAVAADGRALQTLHVDFCRNV 214

  Fly   437 SDQALTHIAQGLYRLRS 453
            |       |.||.|||:
Human   215 S-------AAGLRRLRA 224

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Ppa	NP_001261138.1	F-box-like	149..190	CDD:289689
		AMN1	<226..>334	CDD:187754
		leucine-rich repeat	236..256	CDD:275381
		leucine-rich repeat	263..288	CDD:275381
		leucine-rich repeat	289..314	CDD:275381
		leucine-rich repeat	315..347	CDD:275381
		AMN1	347..524	CDD:187754	29/82 (35%)
		leucine-rich repeat	348..373	CDD:275381	29/82 (35%)
		leucine-rich repeat	374..398	CDD:275381	11/24 (46%)
		leucine-rich repeat	399..424	CDD:275381	6/24 (25%)
		leucine-rich repeat	425..450	CDD:275381	8/24 (33%)
		leucine-rich repeat	451..475	CDD:275381	2/3 (67%)
		leucine-rich repeat	476..501	CDD:275381
FBXL22	XP_011519770.1	AMN1	<148..229	CDD:187754	29/82 (35%)
		leucine-rich repeat	151..176	CDD:275381	11/24 (46%)
		leucine-rich repeat	177..202	CDD:275381	6/24 (25%)
		leucine-rich repeat	203..228	CDD:275381	11/29 (38%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1947
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.810