Sequence 1: | NP_001261138.1 | Gene: | Ppa / 37602 | FlyBaseID: | FBgn0020257 | Length: | 562 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_766576.1 | Gene: | Fbxl4 / 269514 | MGIID: | 2140367 | Length: | 621 | Species: | Mus musculus |
Alignment Length: | 348 | Identity: | 96/348 - (27%) |
---|---|---|---|
Similarity: | 144/348 - (41%) | Gaps: | 62/348 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 145 EGTH---ISNLFPELLEQIFEHLPVRDLGRAAQVCTA-------------------WR------- 180
Fly 181 DAAYAKSV--------WKGVEAKLHLKRSSPSLFNCLVKRGIKKVQI-LSLRRSLKDLVLGV--- 233
Fly 234 --PALTSLNLSGCFNVADMNLGHAFSVDLPNLKTLDLSLCKQITDTSLGRIAQHLRNLETLELGG 296
Fly 297 CCNITNTGLL--LIAWGLKKLKHLNLRSCWHISDQGIGHLAGFSRETAEGNLQLEYLGLQDCQRL 359
Fly 360 --SDEALGHIAQGLTSLKSINLSFCVSVTDSGLKHLA-RMPKLEQLNLRSCDNISDIGMAYLTEG 421
Fly 422 GSGINSLDVSFCDKISDQALTHI 444 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ppa | NP_001261138.1 | F-box-like | 149..190 | CDD:289689 | 15/74 (20%) |
AMN1 | <226..>334 | CDD:187754 | 37/114 (32%) | ||
leucine-rich repeat | 236..256 | CDD:275381 | 8/19 (42%) | ||
leucine-rich repeat | 263..288 | CDD:275381 | 8/24 (33%) | ||
leucine-rich repeat | 289..314 | CDD:275381 | 7/26 (27%) | ||
leucine-rich repeat | 315..347 | CDD:275381 | 10/31 (32%) | ||
AMN1 | 347..524 | CDD:187754 | 30/101 (30%) | ||
leucine-rich repeat | 348..373 | CDD:275381 | 9/26 (35%) | ||
leucine-rich repeat | 374..398 | CDD:275381 | 7/24 (29%) | ||
leucine-rich repeat | 399..424 | CDD:275381 | 6/24 (25%) | ||
leucine-rich repeat | 425..450 | CDD:275381 | 8/20 (40%) | ||
leucine-rich repeat | 451..475 | CDD:275381 | |||
leucine-rich repeat | 476..501 | CDD:275381 | |||
Fbxl4 | NP_766576.1 | F-box-like | 280..318 | CDD:372399 | 12/37 (32%) |
leucine-rich repeat | 295..317 | CDD:275381 | 7/21 (33%) | ||
leucine-rich repeat | 318..340 | CDD:275381 | 1/21 (5%) | ||
leucine-rich repeat | 347..376 | CDD:275381 | 6/32 (19%) | ||
LRR 1 | 376..397 | 7/20 (35%) | |||
leucine-rich repeat | 377..402 | CDD:275381 | 7/24 (29%) | ||
AMN1 | 394..601 | CDD:187754 | 66/216 (31%) | ||
LRR 2 | 402..421 | 6/18 (33%) | |||
leucine-rich repeat | 403..427 | CDD:275381 | 9/25 (36%) | ||
LRR 3 | 427..448 | 8/21 (38%) | |||
leucine-rich repeat | 428..452 | CDD:275381 | 8/24 (33%) | ||
LRR 4 | 452..474 | 6/21 (29%) | |||
leucine-rich repeat | 453..480 | CDD:275381 | 7/26 (27%) | ||
LRR 5 | 480..501 | 8/27 (30%) | |||
leucine-rich repeat | 481..506 | CDD:275381 | 10/31 (32%) | ||
LRR 6 | 504..524 | 7/19 (37%) | |||
leucine-rich repeat | 507..534 | CDD:275381 | 9/26 (35%) | ||
LRR 7 | 532..558 | 8/25 (32%) | |||
leucine-rich repeat | 535..560 | CDD:275381 | 7/24 (29%) | ||
LRR 8 | 559..583 | 5/23 (22%) | |||
leucine-rich repeat | 561..586 | CDD:275381 | 6/24 (25%) | ||
LRR 9 | 584..609 | 8/23 (35%) | |||
leucine-rich repeat | 587..612 | CDD:275381 | 8/20 (40%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |