DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and Fbxl4

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_766576.1 Gene:Fbxl4 / 269514 MGIID:2140367 Length:621 Species:Mus musculus


Alignment Length:348 Identity:96/348 - (27%)
Similarity:144/348 - (41%) Gaps:62/348 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 EGTH---ISNLFPELLEQIFEHLPVRDLGRAAQVCTA-------------------WR------- 180
            :|.|   ...|..||::.|..||.:.||.|.||.|..                   |.       
Mouse   273 DGPHNGYFDKLPYELIQLILNHLSLPDLCRLAQTCRLLHQHCCDPLQYIHLNLQPYWARLDDTSL 337

  Fly   181 DAAYAKSV--------WKGVEAKLHLKRSSPSLFNCLVKRGIKKVQI-LSLRRSLKDLVLGV--- 233
            :...|:.|        |.|....:.:...|..|..|    |.:.|:: ||....|.|..|.|   
Mouse   338 EFLQARCVLVQWLNLSWTGNRGFISVSGFSRFLKVC----GSELVRLELSCSHFLNDTCLEVISE 398

  Fly   234 --PALTSLNLSGCFNVADMNLGHAFSVDLPNLKTLDLSLCKQITDTSLGRIAQHLRNLETLELGG 296
              |.|..||||.|..:.....||.  ..|.:||.|.|...| :..|:|..|......|:.|.||.
Mouse   399 MCPNLQDLNLSSCDKLPPQAFGHI--AKLCSLKRLVLYRTK-VEQTALLSILNFCAELQHLSLGS 460

  Fly   297 CCNITNTGLL--LIAWGLKKLKHLNLRSCWHISDQGIGHLAGFSRETAEGNLQLEYLGLQDCQRL 359
            |..|.:..::  :|....|.|:.|:|..|.:|::.||.       |.|.|.:.||.|.|..|..|
Mouse   461 CVMIEDYDVIASMIGAKCKNLRTLDLWRCKNITENGIA-------ELASGCVLLEELDLGWCPTL 518

  Fly   360 --SDEALGHIAQGLTSLKSINLSFCVSVTDSGLKHLA-RMPKLEQLNLRSCDNISDIGMAYLTEG 421
              |......:|:.|.:|:.:.|:...||.|:.::.|| ...:|:||::.....:|...:..|.|.
Mouse   519 QSSTGCFVRLARQLPNLQKLFLTANRSVCDTDIEELASNCTRLQQLDILGTRMVSPASLRKLLES 583

  Fly   422 GSGINSLDVSFCDKISDQALTHI 444
            ...::.||||||.:|.::|:..:
Mouse   584 CKDLSLLDVSFCSQIDNKAVLEL 606

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689 15/74 (20%)
AMN1 <226..>334 CDD:187754 37/114 (32%)
leucine-rich repeat 236..256 CDD:275381 8/19 (42%)
leucine-rich repeat 263..288 CDD:275381 8/24 (33%)
leucine-rich repeat 289..314 CDD:275381 7/26 (27%)
leucine-rich repeat 315..347 CDD:275381 10/31 (32%)
AMN1 347..524 CDD:187754 30/101 (30%)
leucine-rich repeat 348..373 CDD:275381 9/26 (35%)
leucine-rich repeat 374..398 CDD:275381 7/24 (29%)
leucine-rich repeat 399..424 CDD:275381 6/24 (25%)
leucine-rich repeat 425..450 CDD:275381 8/20 (40%)
leucine-rich repeat 451..475 CDD:275381
leucine-rich repeat 476..501 CDD:275381
Fbxl4NP_766576.1 F-box-like 280..318 CDD:372399 12/37 (32%)
leucine-rich repeat 295..317 CDD:275381 7/21 (33%)
leucine-rich repeat 318..340 CDD:275381 1/21 (5%)
leucine-rich repeat 347..376 CDD:275381 6/32 (19%)
LRR 1 376..397 7/20 (35%)
leucine-rich repeat 377..402 CDD:275381 7/24 (29%)
AMN1 394..601 CDD:187754 66/216 (31%)
LRR 2 402..421 6/18 (33%)
leucine-rich repeat 403..427 CDD:275381 9/25 (36%)
LRR 3 427..448 8/21 (38%)
leucine-rich repeat 428..452 CDD:275381 8/24 (33%)
LRR 4 452..474 6/21 (29%)
leucine-rich repeat 453..480 CDD:275381 7/26 (27%)
LRR 5 480..501 8/27 (30%)
leucine-rich repeat 481..506 CDD:275381 10/31 (32%)
LRR 6 504..524 7/19 (37%)
leucine-rich repeat 507..534 CDD:275381 9/26 (35%)
LRR 7 532..558 8/25 (32%)
leucine-rich repeat 535..560 CDD:275381 7/24 (29%)
LRR 8 559..583 5/23 (22%)
leucine-rich repeat 561..586 CDD:275381 6/24 (25%)
LRR 9 584..609 8/23 (35%)
leucine-rich repeat 587..612 CDD:275381 8/20 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.