DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and FBXL3

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_036290.1 Gene:FBXL3 / 26224 HGNCID:13599 Length:428 Species:Homo sapiens


Alignment Length:411 Identity:81/411 - (19%)
Similarity:144/411 - (35%) Gaps:157/411 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 NLFPELLEQIFEHLPVRDLGRAAQVCTAWRDAAYAKSVWKGVEAKL------HLKRSSPSLFNCL 209
            ||..:::.|:|::||:.|...|:|||..|....:...:|:..|.:|      :||.:.|.|...:
Human    38 NLLQDIILQVFKYLPLLDRAHASQVCRNWNQVFHMPDLWRCFEFELNQPATSYLKATHPELIKQI 102

  Fly   210 VKRGIKKVQILSLR-RSLKDL------VLGVPALTSLNLSGCFNVA-----DMNLGH---AFSVD 259
            :||....:|.:|.: .|.|:.      :|......||...|..:.|     |:...|   |.:|.
Human   103 IKRHSNHLQYVSFKVDSSKESAEAACDILSQLVNCSLKTLGLISTARPSFMDLPKSHFISALTVV 167

  Fly   260 LPNLKTLDLSLCKQITDTSLG------RIAQHLRNLETLELGGCCNITNTGLLLIA---WGLKKL 315
            ..|.|:|. ||  :|.||.:.      .:|.:...|:.|::..|.:::..|:|.:|   .||::|
Human   168 FVNSKSLS-SL--KIDDTPVDDPSLKVLVANNSDTLKLLKMSSCPHVSPAGILCVADQCHGLREL 229

  Fly   316 ------------------KHLNL---------------------RSCWHISDQGIGHLAGFSRET 341
                              ||:.|                     :|.|.          .|.|.:
Human   230 ALNYHLLSDELLLALSSEKHVRLEHLRIDVVSENPGQTHFHTIQKSSWD----------AFIRHS 284

  Fly   342 AEGNLQLE---------------------YLGLQDCQRLSDEALGHIAQGLTSLKSINLSFCVSV 385
            .:.||.:.                     |.|    :.:|.:.||.:  |:|..:.:.|..|.  
Human   285 PKVNLVMYFFLYEEEFDPFFRYEIPATHLYFG----RSVSKDVLGRV--GMTCPRLVELVVCA-- 341

  Fly   386 TDSGLKHLARMPKLEQLNLRSCDNISDIGMAYLTEGGSGINSLDVSFCDKISDQALTHIAQGLYR 450
              :||:.|                                            |:.|..||:....
Human   342 --NGLRPL--------------------------------------------DEELIRIAERCKN 360

  Fly   451 LRSLSLNQCQITDHGMLKIAK 471
            |.::.|.:|:::....::..|
Human   361 LSAIGLGECEVSCSAFVEFVK 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689 12/38 (32%)
AMN1 <226..>334 CDD:187754 33/169 (20%)
leucine-rich repeat 236..256 CDD:275381 6/27 (22%)
leucine-rich repeat 263..288 CDD:275381 8/30 (27%)
leucine-rich repeat 289..314 CDD:275381 8/27 (30%)
leucine-rich repeat 315..347 CDD:275381 9/70 (13%)
AMN1 347..524 CDD:187754 20/146 (14%)
leucine-rich repeat 348..373 CDD:275381 6/45 (13%)
leucine-rich repeat 374..398 CDD:275381 5/23 (22%)
leucine-rich repeat 399..424 CDD:275381 0/24 (0%)
leucine-rich repeat 425..450 CDD:275381 4/24 (17%)
leucine-rich repeat 451..475 CDD:275381 4/21 (19%)
leucine-rich repeat 476..501 CDD:275381
FBXL3NP_036290.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
F-box-like 36..77 CDD:403981 12/38 (32%)
LRR 1 119..146 6/26 (23%)
leucine-rich repeat 174..199 CDD:275381 7/27 (26%)
LRR 2 181..207 5/25 (20%)
leucine-rich repeat 200..225 CDD:275381 6/24 (25%)
LRR 3 208..233 7/24 (29%)
LRR 4 234..259 3/24 (13%)
leucine-rich repeat 252..286 CDD:275381 5/43 (12%)
leucine-rich repeat 287..333 CDD:275381 9/51 (18%)
LRR 5 316..341 7/30 (23%)
leucine-rich repeat 334..360 CDD:275381 9/73 (12%)
LRR 6 343..368 9/68 (13%)
leucine-rich repeat 361..383 CDD:275381 4/21 (19%)
LRR 7 369..394 2/13 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.