DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and pof2

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_596079.1 Gene:pof2 / 2540355 PomBaseID:SPBC25B2.11 Length:463 Species:Schizosaccharomyces pombe


Alignment Length:398 Identity:100/398 - (25%)
Similarity:179/398 - (44%) Gaps:62/398 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 ELLEQIFEHLPVRDLGRAAQVCTAWRDAAYAKSVWKGV----EAKLHLKRSSPSLFNCL------ 209
            |:...|..:|...:|...:.|||:||: ....::|:.|    ||:|:      :.|:.|      
pombe     6 EVCFNILSYLEADELRCKSTVCTSWRN-FIIPTLWEKVVFQNEAQLN------NFFDTLQYSKDV 63

  Fly   210 --VKRGIKKVQILSLRRSLKD----LVLGVPALTSLNLSGCFNVADMNLGHAFSVDLPNLKTLDL 268
              ..|.::|:....:|:.|.|    |:.....::.||||||..:::..:|.....:| ||.|::.
pombe    64 SYYFRYLRKLNCSRVRKFLTDKHLMLMTLATGISRLNLSGCTRISEPLIGKLLYQNL-NLVTINF 127

  Fly   269 SLCKQITDTSLGRIAQHLRNLETLELGGCCNITNTGLLLIAWGLKKLKHLNLRSCWHISDQGIGH 333
            |....:....|..|:.:..||:.|.:|.|..:.:||::.|   :|:..:||              
pombe   128 SNIFSLPANILEYISDNCPNLKALNIGNCGLVEDTGMVQI---IKRCPYLN-------------- 175

  Fly   334 LAGFSRETAEGNLQLEYLGLQDCQRLSDEALGHIAQGLTSLKSINLSFCVSV--TDSGLKHLARM 396
                            .|.:.:|::|:|.:| .|......|..:::|.|...  .|:..:.::|.
pombe   176 ----------------RLIIPNCRKLTDVSL-QILSEKEDLIELDISGCEGFHNADTLSRLVSRN 223

  Fly   397 PKLEQLNLRSCDNISD-IGMAYLTEGGSGINSLDVSFCDKISDQALTHIAQGLYRLRSLSLNQC- 459
            ..|::|::..|..:|. |....|......:.:|.::....:.|..:..|.....:|.||.|::| 
pombe   224 RGLKELSMDGCTELSHFITFLNLNCELDAMRALSLNNLPDLKDSDIELITCKFSKLNSLFLSKCI 288

  Fly   460 QITDHGMLKIAKALHELENLNIGQCSRITDKGLQTLAEDLTNLKTIDLYGCTQLSSKGIDIIMKL 524
            .:||..:|.:.|....|..|::|.|..|||.|:|.|.:...|:..||..||.:||...:..|.||
pombe   289 GLTDSSLLSLTKLSQSLTTLHLGHCYEITDIGVQCLLKSCKNITYIDFGGCLRLSDIAVSAIAKL 353

  Fly   525 PKLQKLNL 532
            |.||::.|
pombe   354 PYLQRVGL 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689 9/34 (26%)
AMN1 <226..>334 CDD:187754 28/111 (25%)
leucine-rich repeat 236..256 CDD:275381 7/19 (37%)
leucine-rich repeat 263..288 CDD:275381 5/24 (21%)
leucine-rich repeat 289..314 CDD:275381 7/24 (29%)
leucine-rich repeat 315..347 CDD:275381 2/31 (6%)
AMN1 347..524 CDD:187754 47/180 (26%)
leucine-rich repeat 348..373 CDD:275381 6/24 (25%)
leucine-rich repeat 374..398 CDD:275381 5/25 (20%)
leucine-rich repeat 399..424 CDD:275381 6/25 (24%)
leucine-rich repeat 425..450 CDD:275381 3/24 (13%)
leucine-rich repeat 451..475 CDD:275381 9/24 (38%)
leucine-rich repeat 476..501 CDD:275381 10/24 (42%)
pof2NP_596079.1 F-box-like 2..45 CDD:289689 11/39 (28%)
leucine-rich repeat 96..121 CDD:275381 8/25 (32%)
leucine-rich repeat 122..141 CDD:275381 4/18 (22%)
AMN1 <143..292 CDD:187754 36/182 (20%)
leucine-rich repeat 148..173 CDD:275381 8/27 (30%)
leucine-rich repeat 174..225 CDD:275381 13/81 (16%)
leucine-rich repeat 226..278 CDD:275381 9/51 (18%)
AMN1 <278..428 CDD:187754 33/84 (39%)
leucine-rich repeat 279..304 CDD:275381 9/24 (38%)
leucine-rich repeat 305..330 CDD:275381 10/24 (42%)
leucine-rich repeat 331..355 CDD:275381 9/23 (39%)
leucine-rich repeat 356..382 CDD:275381 3/6 (50%)
leucine-rich repeat 383..408 CDD:275381
leucine-rich repeat 409..427 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm47209
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.