Sequence 1: | NP_001261138.1 | Gene: | Ppa / 37602 | FlyBaseID: | FBgn0020257 | Length: | 562 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001355337.1 | Gene: | Lrrc29 / 234684 | MGIID: | 2443262 | Length: | 621 | Species: | Mus musculus |
Alignment Length: | 574 | Identity: | 121/574 - (21%) |
---|---|---|---|
Similarity: | 198/574 - (34%) | Gaps: | 217/574 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 155 ELLEQIFEHLPVRDLGRAAQVCTAWRDAAYAKSVWKGVEAKLHLKRSSPSLFNCLVKRGIKKVQI 219
Fly 220 LSL--------------------------------RRSLKDLVLGVPALTSLNLSGC-------- 244
Fly 245 --------------------FNVA------DMNLGHAFSVDLPNLKTLDLSLCK----------- 272
Fly 273 ----------------------------------------------QITDTSLGRIAQH-LRNLE 290
Fly 291 ---------------TLELGGCCNITNTGLLLIAWGLKKLKHLNLRSCWHISDQGIGHLAGFSRE 340
Fly 341 TAEGNLQLEYLGLQDCQRLSD----EALGHIAQGLTSLKSINLSFCVSVTDSGLKHL--ARMPKL 399
Fly 400 EQLNLRS--------------------------CDNISDIGMAYLTE------------------ 420
Fly 421 ------------GGS-----GINSLDVSFCDKISDQALTHIAQGLYRLRSLSLNQC-QITDHGML 467
Fly 468 KIAKALHELENLNIGQCSRITDKGLQTLAEDLTNLKTIDLYGCTQLSSKGIDII 521 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ppa | NP_001261138.1 | F-box-like | 149..190 | CDD:289689 | 11/34 (32%) |
AMN1 | <226..>334 | CDD:187754 | 41/214 (19%) | ||
leucine-rich repeat | 236..256 | CDD:275381 | 10/53 (19%) | ||
leucine-rich repeat | 263..288 | CDD:275381 | 8/82 (10%) | ||
leucine-rich repeat | 289..314 | CDD:275381 | 10/39 (26%) | ||
leucine-rich repeat | 315..347 | CDD:275381 | 10/31 (32%) | ||
AMN1 | 347..524 | CDD:187754 | 56/243 (23%) | ||
leucine-rich repeat | 348..373 | CDD:275381 | 6/28 (21%) | ||
leucine-rich repeat | 374..398 | CDD:275381 | 7/25 (28%) | ||
leucine-rich repeat | 399..424 | CDD:275381 | 11/85 (13%) | ||
leucine-rich repeat | 425..450 | CDD:275381 | 7/24 (29%) | ||
leucine-rich repeat | 451..475 | CDD:275381 | 9/24 (38%) | ||
leucine-rich repeat | 476..501 | CDD:275381 | 8/24 (33%) | ||
Lrrc29 | NP_001355337.1 | F-box-like | 3..38 | CDD:372399 | 11/29 (38%) |
leucine-rich repeat | 70..83 | CDD:275381 | 1/12 (8%) | ||
LRR_RI | <118..360 | CDD:393385 | 48/250 (19%) | ||
leucine-rich repeat | 121..154 | CDD:275381 | 6/32 (19%) | ||
leucine-rich repeat | 155..180 | CDD:275381 | 5/25 (20%) | ||
leucine-rich repeat | 181..227 | CDD:275381 | 4/45 (9%) | ||
leucine-rich repeat | 228..248 | CDD:275381 | 0/19 (0%) | ||
AMN1 | 240..428 | CDD:187754 | 44/195 (23%) | ||
leucine-rich repeat | 254..277 | CDD:275381 | 4/22 (18%) | ||
leucine-rich repeat | 280..305 | CDD:275381 | 9/24 (38%) | ||
leucine-rich repeat | 306..360 | CDD:275381 | 16/61 (26%) | ||
leucine-rich repeat | 331..356 | CDD:275381 | 6/24 (25%) | ||
leucine-rich repeat | 361..387 | CDD:275381 | 7/25 (28%) | ||
leucine-rich repeat | 388..413 | CDD:275381 | 4/24 (17%) | ||
leucine-rich repeat | 414..474 | CDD:275381 | 7/59 (12%) | ||
AMN1 | <475..589 | CDD:187754 | 31/98 (32%) | ||
leucine-rich repeat | 475..525 | CDD:275381 | 16/50 (32%) | ||
leucine-rich repeat | 526..551 | CDD:275381 | 8/24 (33%) | ||
leucine-rich repeat | 552..577 | CDD:275381 | 7/20 (35%) | ||
leucine-rich repeat | 578..603 | CDD:275381 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |