DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and KDM2A

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_036440.1 Gene:KDM2A / 22992 HGNCID:13606 Length:1162 Species:Homo sapiens


Alignment Length:310 Identity:79/310 - (25%)
Similarity:122/310 - (39%) Gaps:71/310 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 ELLEQIFEHLPVRDLGRAAQVCTAWRDAAYAKSVWKGVEAKLHLKRSS---PSLFNCLVKRGIKK 216
            |:...:|.:|..|:|....:||..|......|.:|    .|:.|.|..   |...:.::||    
Human   896 EVWMSVFRYLSRRELCECMRVCKTWYKWCCDKRLW----TKIDLSRCKAIVPQALSGIIKR---- 952

  Fly   217 VQILSL--------RRSLKDLVLGVPALTSLNLSGCFNVADMNLGHAFSVDLPNLKTLDLSLCKQ 273
             |.:||        ::.|..||..:|.|..|.|:||...|...|.   :...|.|:||||.....
Human   953 -QPVSLDLSWTNISKKQLTWLVNRLPGLKDLLLAGCSWSAVSALS---TSSCPLLRTLDLRWAVG 1013

  Fly   274 ITDTSLGRI------------AQHLRNLETLELGGCCNITNTGLLLIAWGLKKLKHLNLRSCWHI 326
            |.|..:..:            ...|||:....|.| .:||:..|.||...:..|..|:|..|.|:
Human  1014 IKDPQIRDLLTPPADKPGQDNRSKLRNMTDFRLAG-LDITDATLRLIIRHMPLLSRLDLSHCSHL 1077

  Fly   327 SDQGIGHLAGFSRETAEGNLQLEYLGLQDCQRLSDEALGHIAQGLTSLKSINLSFCVSVTDSGLK 391
            :||....|......|   ...|..|.:..|.:|:|:.|.::.: :.::..|:|..|..:|....:
Human  1078 TDQSSNLLTAVGSST---RYSLTELNMAGCNKLTDQTLIYLRR-IANVTLIDLRGCKQITRKACE 1138

  Fly   392 HLARMPKLEQLNLRSCDNISDIGMAYLTEGGSGINSLDVSFCDKISDQAL 441
            |.                |||:          .||||   :|  :||:.|
Human  1139 HF----------------ISDL----------SINSL---YC--LSDEKL 1157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689 9/34 (26%)
AMN1 <226..>334 CDD:187754 36/119 (30%)
leucine-rich repeat 236..256 CDD:275381 7/19 (37%)
leucine-rich repeat 263..288 CDD:275381 8/36 (22%)
leucine-rich repeat 289..314 CDD:275381 7/24 (29%)
leucine-rich repeat 315..347 CDD:275381 9/31 (29%)
AMN1 347..524 CDD:187754 22/95 (23%)
leucine-rich repeat 348..373 CDD:275381 6/24 (25%)
leucine-rich repeat 374..398 CDD:275381 5/23 (22%)
leucine-rich repeat 399..424 CDD:275381 3/24 (13%)
leucine-rich repeat 425..450 CDD:275381 8/17 (47%)
leucine-rich repeat 451..475 CDD:275381
leucine-rich repeat 476..501 CDD:275381
KDM2ANP_036440.1 cupin_like 199..299 CDD:328732
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 367..389
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 532..557
zf-CXXC <576..609 CDD:251032
PHD_KDM2A 619..675 CDD:277113
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 704..789
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 839..887
F-box-like 896..934 CDD:315592 11/41 (27%)
leucine-rich repeat 930..954 CDD:275381 7/32 (22%)
AMN1 932..1138 CDD:332986 57/218 (26%)
leucine-rich repeat 955..978 CDD:275381 5/22 (23%)
LRR 1 961..982 5/20 (25%)
leucine-rich repeat 979..1002 CDD:275381 7/25 (28%)
LRR 2 984..1010 11/28 (39%)
leucine-rich repeat 1003..1040 CDD:275381 8/36 (22%)
leucine-rich repeat 1041..1065 CDD:275381 7/24 (29%)
LRR 3 1048..1073 9/25 (36%)
leucine-rich repeat 1066..1095 CDD:275381 9/31 (29%)
LRR 4 1074..1103 8/31 (26%)
leucine-rich repeat 1096..1120 CDD:275381 6/24 (25%)
LRR 5 1104..1128 6/24 (25%)
leucine-rich repeat 1121..1140 CDD:275381 4/18 (22%)
LRR 6 1129..1156 13/57 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.