DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and Kdm2a

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001001984.2 Gene:Kdm2a / 225876 MGIID:1354736 Length:1161 Species:Mus musculus


Alignment Length:310 Identity:78/310 - (25%)
Similarity:121/310 - (39%) Gaps:71/310 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 ELLEQIFEHLPVRDLGRAAQVCTAWRDAAYAKSVWKGVEAKLHLKRSS---PSLFNCLVKRGIKK 216
            |:...:|.:|..::|....:||..|......|.:|    .|:.|.|..   |...:.::||    
Mouse   895 EVWMSVFRYLSRKELCECMRVCKTWYKWCCDKRLW----TKIDLSRCKAIVPQALSGIIKR---- 951

  Fly   217 VQILSL--------RRSLKDLVLGVPALTSLNLSGCFNVADMNLGHAFSVDLPNLKTLDLSLCKQ 273
             |.:||        ::.|..||..:|.|..|.|:||...|...|.   :...|.|:||||.....
Mouse   952 -QPVSLDLSWTNISKKQLTWLVNRLPGLKDLLLAGCSWSAVSALS---TSSCPLLRTLDLRWAVG 1012

  Fly   274 ITDTSLGRI------------AQHLRNLETLELGGCCNITNTGLLLIAWGLKKLKHLNLRSCWHI 326
            |.|..:..:            ...|||:....|.| .:||:..|.||...:..|..|:|..|.|:
Mouse  1013 IKDPQIRDLLTPPTDKPGQDNRSKLRNMTDFRLAG-LDITDATLRLIIRHMPLLSRLDLSHCSHL 1076

  Fly   327 SDQGIGHLAGFSRETAEGNLQLEYLGLQDCQRLSDEALGHIAQGLTSLKSINLSFCVSVTDSGLK 391
            :||....|......|   ...|..|.:..|.:|:|:.|..:.: :.::..|:|..|..:|....:
Mouse  1077 TDQSSNLLTAVGSST---RYSLTELNMAGCNKLTDQTLFFLRR-IANVTLIDLRGCKQITRKACE 1137

  Fly   392 HLARMPKLEQLNLRSCDNISDIGMAYLTEGGSGINSLDVSFCDKISDQAL 441
            |.                |||:          .||||   :|  :||:.|
Mouse  1138 HF----------------ISDL----------SINSL---YC--LSDEKL 1156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689 8/34 (24%)
AMN1 <226..>334 CDD:187754 36/119 (30%)
leucine-rich repeat 236..256 CDD:275381 7/19 (37%)
leucine-rich repeat 263..288 CDD:275381 8/36 (22%)
leucine-rich repeat 289..314 CDD:275381 7/24 (29%)
leucine-rich repeat 315..347 CDD:275381 9/31 (29%)
AMN1 347..524 CDD:187754 22/95 (23%)
leucine-rich repeat 348..373 CDD:275381 6/24 (25%)
leucine-rich repeat 374..398 CDD:275381 5/23 (22%)
leucine-rich repeat 399..424 CDD:275381 3/24 (13%)
leucine-rich repeat 425..450 CDD:275381 8/17 (47%)
leucine-rich repeat 451..475 CDD:275381
leucine-rich repeat 476..501 CDD:275381
Kdm2aNP_001001984.2 cupin_like 199..299 CDD:389752
JHD 304..>339 CDD:375347
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 419..445
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 532..557
zf-CXXC <576..609 CDD:366873
PHD_KDM2A 619..675 CDD:277113
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 705..789
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 840..886
F-box-like 895..933 CDD:372399 10/41 (24%)
leucine-rich repeat 929..953 CDD:275381 7/32 (22%)
AMN1 931..1137 CDD:187754 57/218 (26%)
leucine-rich repeat 954..977 CDD:275381 5/22 (23%)
LRR 1 960..981 5/20 (25%)
leucine-rich repeat 978..1001 CDD:275381 7/25 (28%)
LRR 2 983..1009 11/28 (39%)
leucine-rich repeat 1002..1039 CDD:275381 8/36 (22%)
leucine-rich repeat 1040..1064 CDD:275381 7/24 (29%)
LRR 3 1047..1072 9/25 (36%)
leucine-rich repeat 1065..1094 CDD:275381 9/31 (29%)
LRR 4 1073..1102 8/31 (26%)
leucine-rich repeat 1095..1119 CDD:275381 6/24 (25%)
LRR 5 1103..1127 6/24 (25%)
leucine-rich repeat 1120..1139 CDD:275381 4/18 (22%)
LRR 6 1128..1155 13/57 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.