DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and FBXL13

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001381423.1 Gene:FBXL13 / 222235 HGNCID:21658 Length:825 Species:Homo sapiens


Alignment Length:483 Identity:118/483 - (24%)
Similarity:204/483 - (42%) Gaps:115/483 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 NLFPE-LLEQIFEHLPVRDLGRAAQVCTAWRDAAYAKSVWKGVEAKLHLKRSSPSLF-------- 206
            :|.|| .:.|||.:|.::|:....||..||.......|:|..::.. .:|...|..:        
Human   246 SLLPERAILQIFFYLSLKDVIICGQVNHAWMLMTQLNSLWNAIDFS-SVKNVIPDKYIVSTLQRW 309

  Fly   207 ----------NCLVKRGIKKVQILSLRRSLKDLVLGVPALTSLNLSGCFNVADMNLGHAFSVDLP 261
                      .||::.  |..:.:|..|:|::          ||:|.|....|.::.| .|...|
Human   310 RLNVLRLNFRGCLLRP--KTFRSVSHCRNLQE----------LNVSDCPTFTDESMRH-ISEGCP 361

  Fly   262 NLKTLDLSLCKQITDTSLGRIAQHLRNLETLELGGCCNITNTGL--LLIAWGLKKLKHLNLRSCW 324
            .:..|:|| ...||:.::..:.:|..||:.|.|..|...|:.||  |.:..|..||.:|:|..|.
Human   362 GVLCLNLS-NTTITNRTMRLLPRHFHNLQNLSLAYCRRFTDKGLQYLNLGNGCHKLIYLDLSGCT 425

  Fly   325 HISDQGIGHLAG---------------------------FSRETA-------------------- 342
            .||.||..::|.                           .||.|:                    
Human   426 QISVQGFRYIANSCTGIMHLTINDMPTLTDNCVKALVEKCSRITSLVFTGAPHISDCTFRALSAC 490

  Fly   343 -------EGNLQ---------------LEYLGLQDCQRLSDEALGHIAQGLTSLKSINLSFCVSV 385
                   |||.:               |.::.:.||:.::|.:|..::. |..|..:||:.||.:
Human   491 KLRKIRFEGNKRVTDASFKFIDKNYPNLSHIYMADCKGITDSSLRSLSP-LKQLTVLNLANCVRI 554

  Fly   386 TDSGLKHLARMP---KLEQLNLRSCDNISDIGMAYLTEGGSGINSLDVSFCDKISDQALTHIAQG 447
            .|.|||.....|   ::.:|||.:|..:||..:..|:|....:|.|.:..|:.::.|.:.:|. .
Human   555 GDMGLKQFLDGPASMRIRELNLSNCVRLSDASVMKLSERCPNLNYLSLRNCEHLTAQGIGYIV-N 618

  Fly   448 LYRLRSLSLNQCQITDHGMLKIAKALHELENLNIGQCSRITDKGLQTLAEDLTNLKTIDLYGCTQ 512
            ::.|.|:.|:...|::.| |.:.....:|:.|::.:|.||||.|:|...:....|:.:|:..|:|
Human   619 IFSLVSIDLSGTDISNEG-LNVLSRHKKLKELSVSECYRITDDGIQAFCKSSLILEHLDVSYCSQ 682

  Fly   513 LSSKGIDIIMKLPKLQKLNLGLWLVRXC 540
            ||    |:|:|...:..:||....:..|
Human   683 LS----DMIIKALAIYCINLTSLSIAGC 706

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689 13/39 (33%)
AMN1 <226..>334 CDD:187754 34/109 (31%)
leucine-rich repeat 236..256 CDD:275381 6/19 (32%)
leucine-rich repeat 263..288 CDD:275381 6/24 (25%)
leucine-rich repeat 289..314 CDD:275381 9/26 (35%)
leucine-rich repeat 315..347 CDD:275381 15/85 (18%)
AMN1 347..524 CDD:187754 52/194 (27%)
leucine-rich repeat 348..373 CDD:275381 6/24 (25%)
leucine-rich repeat 374..398 CDD:275381 10/26 (38%)
leucine-rich repeat 399..424 CDD:275381 8/24 (33%)
leucine-rich repeat 425..450 CDD:275381 5/24 (21%)
leucine-rich repeat 451..475 CDD:275381 6/23 (26%)
leucine-rich repeat 476..501 CDD:275381 9/24 (38%)
FBXL13NP_001381423.1 Sfi1 <112..>224 CDD:400658
F-box-like 245..289 CDD:403981 14/42 (33%)
leucine-rich repeat 285..312 CDD:275381 3/27 (11%)
AMN1 312..497 CDD:187754 43/198 (22%)
leucine-rich repeat 313..336 CDD:275381 4/24 (17%)
leucine-rich repeat 337..362 CDD:275381 8/35 (23%)
leucine-rich repeat 363..387 CDD:275381 6/24 (25%)
leucine-rich repeat 388..406 CDD:275381 7/17 (41%)
leucine-rich repeat 416..441 CDD:275381 9/24 (38%)
leucine-rich repeat 442..491 CDD:275381 3/48 (6%)
leucine-rich repeat 468..490 CDD:275381 1/21 (5%)
leucine-rich repeat 492..515 CDD:275381 3/22 (14%)
leucine-rich repeat 518..542 CDD:275381 6/24 (25%)
AMN1 529..737 CDD:187754 53/185 (29%)
leucine-rich repeat 543..570 CDD:275381 10/26 (38%)
leucine-rich repeat 571..596 CDD:275381 8/24 (33%)
leucine-rich repeat 597..645 CDD:275381 11/49 (22%)
leucine-rich repeat 646..671 CDD:275381 9/24 (38%)
leucine-rich repeat 672..697 CDD:275381 9/28 (32%)
leucine-rich repeat 698..723 CDD:275381 2/9 (22%)
leucine-rich repeat 724..749 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1282076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.