DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and Fbxl16

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001366323.1 Gene:Fbxl16 / 214931 MGIID:2448488 Length:575 Species:Mus musculus


Alignment Length:497 Identity:135/497 - (27%)
Similarity:222/497 - (44%) Gaps:90/497 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 ELPGLTR-TGATTTHHHLLRFTPYALHH--RPPHHQLQTLPP---ALYLQHAAAAAAAAAAAAAH 120
            :|||... .||.:    :.:.||.|.:.  :||  ...||||   |..|...|.|......|:. 
Mouse   118 KLPGQPNGLGAAS----ITKGTPAAKNRPCQPP--PPPTLPPPSLATPLSRVALAGGPCPPASG- 175

  Fly   121 AQHHHHHHHHLPHRPAS-PESPPPVEGTHISNLFPELLEQIFEHLPVRDLGRAAQVCTAWRDAAY 184
                          ||| |.|.||||...::. ..::|..:|.:....:....||||.|||...|
Mouse   176 --------------PASGPVSGPPVERPPLAT-DEKILNGLFWYFSACEKCILAQVCKAWRRVLY 225

  Fly   185 AKSVWKGVEAKLHLKRSSPSLFNCLVKRGIKKVQILSLRRSLKDLVLGVPALTSLNLSG------ 243
            ....|.|:...||.|    .|:|.| ..|.|:.                     :||.|      
Mouse   226 QPKFWAGLTPVLHAK----ELYNVL-PGGEKEF---------------------VNLQGFAARGF 264

  Fly   244 ---CF-NVADMNLGH---AFSVDLPNLKTLDLSLCKQITDTSLGRIAQHLRNLETLELGGCCNIT 301
               |. .|:|:::..   .:|:....:|.:.|.. ..|||..|..:.:.::.:..|||.||.:.|
Mouse   265 EGFCLVGVSDLDICEFIDNYSLSKKGVKAMSLKR-STITDAGLEVMLEQMQGVVRLELSGCNDFT 328

  Fly   302 NTGLLLIAWG--LKKLKHLNLRSCWHISDQGIGHLAGFSRETAEGNLQLEYLGLQDCQRLSDEAL 364
            ..||    |.  ..::..|::..|.:::|..|..::......||.:||        ...::|.||
Mouse   329 EAGL----WSSLSARITSLSVSDCINVADDAIAAISQLLPNLAELSLQ--------AYHVTDTAL 381

  Fly   365 GHIA--QGLTSLKSINLSFCVSVTDSGLKHLAR-MPKLEQLNLRSCDNISDIGMAYLTEGGSGIN 426
            .:..  || .|..::.|..|..:|:.|:.::.. :|.|..|:|..|..::|.|:..:.|....:.
Mouse   382 AYFTARQG-HSTHTLRLLSCWEITNHGVVNVVHSLPNLTSLSLSGCSKVTDDGVELVAENLRKLR 445

  Fly   427 SLDVSFCDKISDQALTHIAQGLYRLRSLSLNQC-QITDHGMLKIAKALHELENLNIGQCSRITDK 490
            |||:|:|.:|:|.||.::|..|:||..|.|::| :|||.| |.....:..|.:|.:..|.::.|.
Mouse   446 SLDLSWCPRITDMALEYVACDLHRLEELVLDRCVRITDTG-LSYLSTMSSLRSLYLRWCCQVQDF 509

  Fly   491 GLQTLAEDLTNLKTIDLYGCTQLSSKGIDIIMKLPKLQKLNL 532
            ||:.|.. :.||:.:.|.||..|::.|:..:::|.:|::|.|
Mouse   510 GLKHLLA-MRNLRLLSLAGCPLLTTTGLSGLVQLQELEELEL 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689 10/40 (25%)
AMN1 <226..>334 CDD:187754 26/122 (21%)
leucine-rich repeat 236..256 CDD:275381 6/32 (19%)
leucine-rich repeat 263..288 CDD:275381 6/24 (25%)
leucine-rich repeat 289..314 CDD:275381 9/26 (35%)
leucine-rich repeat 315..347 CDD:275381 6/31 (19%)
AMN1 347..524 CDD:187754 54/180 (30%)
leucine-rich repeat 348..373 CDD:275381 5/26 (19%)
leucine-rich repeat 374..398 CDD:275381 4/24 (17%)
leucine-rich repeat 399..424 CDD:275381 7/24 (29%)
leucine-rich repeat 425..450 CDD:275381 11/24 (46%)
leucine-rich repeat 451..475 CDD:275381 9/24 (38%)
leucine-rich repeat 476..501 CDD:275381 7/24 (29%)
Fbxl16NP_001366323.1 PHA03247 <31..193 CDD:223021 28/95 (29%)
AMN1 297..509 CDD:187754 63/226 (28%)
leucine-rich repeat 316..339 CDD:275381 9/26 (35%)
leucine-rich repeat 340..365 CDD:275381 4/24 (17%)
leucine-rich repeat 366..391 CDD:275381 9/33 (27%)
leucine-rich repeat 392..417 CDD:275381 4/24 (17%)
leucine-rich repeat 418..443 CDD:275381 7/24 (29%)
leucine-rich repeat 444..469 CDD:275381 11/24 (46%)
leucine-rich repeat 470..494 CDD:275381 9/24 (38%)
leucine-rich repeat 495..514 CDD:275381 6/18 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1282076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.