DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and skpt-1

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_741137.1 Gene:skpt-1 / 175749 WormBaseID:WBGene00018613 Length:421 Species:Caenorhabditis elegans


Alignment Length:373 Identity:87/373 - (23%)
Similarity:134/373 - (35%) Gaps:102/373 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 ELLEQIFEHLPVRDLGRAAQVCTAWRDAAYAKSVWKGVEAKLHLKRSSPSLFNCLVKRGIKKVQI 219
            |:.||||.:|..:||..|..||..:....:....|...:|     :..|.....|:....:|:::
 Worm    96 EITEQIFSNLKKKDLLSAMLVCHRFYGIGHKSRNWIITDA-----QDRPISEISLIALSQRKIKV 155

  Fly   220 LSLRRSLKDLVLGVPALTSLNLSGCFNVADMNLGHAFSVDLPNLKTLDLSL-------------- 270
            |.|..:..|.:|.               ||..|.....:....|:.||||.              
 Worm   156 LRLAGAKADRILR---------------ADERLVEVALLSTSRLELLDLSRTNLTARQMQIMLKP 205

  Fly   271 CKQITDTSL--GRIAQHL-------RNLETLELGGCCNITNTGLLLIAWGLKKLKHLNLRSCWHI 326
            |:::...|:  .::..|:       |.|..|::.....||..|..||....|.|:.|||..|   
 Worm   206 CQKLKCLSIEGNQLDDHVAICIAENRGLRELDISMTNGITANGASLIFRNCKDLQQLNLAWC--- 267

  Fly   327 SDQGIGHLAGFSRETAEGNLQLEYLGL-QDCQRLSDEALGHIAQGLTSLKSINLSFCVSVTDSGL 390
                                     || |....:...::|.      .||.:|||..|.......
 Worm   268 -------------------------GLTQPIVTVIIHSIGE------KLKKLNLSGTVRNFGINN 301

  Fly   391 KHLARMPKLEQLNLRSCDNISDIGMAYLTEGGSGINSLDVSFCDKISDQALTHIAQGLYRLRSLS 455
            ||      :|.|..:|         .|:|:       ||:|...:|||..|..|.....||.::|
 Worm   302 KH------IEILAAKS---------NYVTD-------LDLSDNVEISDPGLAVILNKFPRLTTIS 344

  Fly   456 LNQCQITDHGMLKIAKALHELENLNIGQCSRITDKGLQTLAEDLTNLK 503
            ||:|...|..|:....:...|..||:..|  ::|..::...|..:|||
 Worm   345 LNRCYGLDPNMVVHFNSKPSLVYLNVHGC--VSDTNMELFLEMCSNLK 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689 11/34 (32%)
AMN1 <226..>334 CDD:187754 27/130 (21%)
leucine-rich repeat 236..256 CDD:275381 3/19 (16%)
leucine-rich repeat 263..288 CDD:275381 8/47 (17%)
leucine-rich repeat 289..314 CDD:275381 7/24 (29%)
leucine-rich repeat 315..347 CDD:275381 5/31 (16%)
AMN1 347..524 CDD:187754 42/158 (27%)
leucine-rich repeat 348..373 CDD:275381 4/25 (16%)
leucine-rich repeat 374..398 CDD:275381 8/23 (35%)
leucine-rich repeat 399..424 CDD:275381 5/24 (21%)
leucine-rich repeat 425..450 CDD:275381 8/24 (33%)
leucine-rich repeat 451..475 CDD:275381 7/23 (30%)
leucine-rich repeat 476..501 CDD:275381 6/24 (25%)
skpt-1NP_741137.1 F-box-like 92..130 CDD:372399 11/33 (33%)
AMN1 150..373 CDD:187754 66/293 (23%)
leucine-rich repeat 153..183 CDD:275381 7/44 (16%)
leucine-rich repeat 184..208 CDD:275381 6/23 (26%)
leucine-rich repeat 209..232 CDD:275381 2/22 (9%)
leucine-rich repeat 233..258 CDD:275381 7/24 (29%)
leucine-rich repeat 259..284 CDD:275381 9/58 (16%)
leucine-rich repeat 285..313 CDD:275381 11/42 (26%)
leucine-rich repeat 314..339 CDD:275381 9/31 (29%)
leucine-rich repeat 340..362 CDD:275381 7/21 (33%)
leucine-rich repeat 365..388 CDD:275381 6/24 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162684
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.