DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and T01E8.1

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001364580.1 Gene:T01E8.1 / 174584 WormBaseID:WBGene00011331 Length:516 Species:Caenorhabditis elegans


Alignment Length:406 Identity:77/406 - (18%)
Similarity:149/406 - (36%) Gaps:136/406 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 NLKTLDLSLCKQITDTSLGRIAQHLRNLETLELGGCCNITNTGLLLIAWGLKKLKHLNLRSCWHI 326
            |:.:|...|..::||..|.::..:.:.:|.:.|..|.|:||.|...:..|...|:.|.||:...:
 Worm    60 NIPSLTFYLSAELTDEMLNQLTTNNKYVEKITLVDCPNVTNLGAQAVTTGQILLRQLELRAMHQL 124

  Fly   327 SDQGIGH----------LAGFSRETAEG-------NLQLEYLGLQDCQRLSDEALGHIAQGL-TS 373
            :||.:.:          |:|..:.|::|       |..:..|.|..|:.|.|:.|..||..: ..
 Worm   125 TDQCLENVYSPFLYSVDLSGCGKITSQGIRTLLIKNPTIGCLYLNHCRSLDDQVLYDIAHYVGDR 189

  Fly   374 LKSINLSFCVSVTD--SGLKHL-ARMPKLEQLNLRSC--DNISDI--GMAYLTEGGSGINSLDV- 430
            |..:.|.|..|:.|  :.|.:| ::.|.|.||:|...  :|:.|:  .:.::.:||: :.:||: 
 Worm   190 LHVLELDFPTSLADPAAALHYLSSQCPNLSQLSLARFFHENLEDVENNVQFVIDGGN-LKTLDLY 253

  Fly   431 -------------------------------------SFCDKIS-------------DQA----- 440
                                                 .|.:.|:             |.|     
 Worm   254 GNYFSLMPQLPPTVQSIRLSVSGDEDSQQLLSTLMDQPFLNSINLIVSVREANIQAVDNANHLLC 318

  Fly   441 ----------------------------------LTHIA--------------------QGLYRL 451
                                              |||::                    ....:|
 Worm   319 AIIPLLGHKITKLQISVPRLFDEPLKLVTEYLPNLTHLSLEINHLNTNILQKYFAGGSKSNASKL 383

  Fly   452 RSLSLNQCQITDHGMLKIAKALHELENLNIGQCSRITDKGLQTLAEDLTNLKTIDLYGCTQLSSK 516
            :.|.:.:.::|...:..||:....|.:|.....|.:.|:.|..|..:...|:.:::.||..:|.|
 Worm   384 KCLKICRMRMTYRVLFAIARGARNLTDLETSHMSSVDDRFLCLLGGNCRQLRCLNINGCRMVSDK 448

  Fly   517 GIDIIMKLPKLQKLNL 532
            |:.::.|...|:::.:
 Worm   449 GLAVLAKRCPLREVRI 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689
AMN1 <226..>334 CDD:187754 20/81 (25%)
leucine-rich repeat 236..256 CDD:275381
leucine-rich repeat 263..288 CDD:275381 5/24 (21%)
leucine-rich repeat 289..314 CDD:275381 8/24 (33%)
leucine-rich repeat 315..347 CDD:275381 11/48 (23%)
AMN1 347..524 CDD:187754 50/294 (17%)
leucine-rich repeat 348..373 CDD:275381 8/25 (32%)
leucine-rich repeat 374..398 CDD:275381 7/26 (27%)
leucine-rich repeat 399..424 CDD:275381 8/28 (29%)
leucine-rich repeat 425..450 CDD:275381 9/134 (7%)
leucine-rich repeat 451..475 CDD:275381 5/23 (22%)
leucine-rich repeat 476..501 CDD:275381 6/24 (25%)
T01E8.1NP_001364580.1 leucine-rich repeat 190..217 CDD:275381 7/26 (27%)
leucine-rich repeat 328..352 CDD:275381 0/23 (0%)
leucine-rich repeat 353..382 CDD:275381 3/28 (11%)
leucine-rich repeat 383..407 CDD:275381 5/23 (22%)
leucine-rich repeat 408..433 CDD:275381 6/24 (25%)
AMN1 <430..>512 CDD:187754 8/35 (23%)
leucine-rich repeat 434..452 CDD:275381 6/17 (35%)
leucine-rich repeat 459..483 CDD:275381 1/6 (17%)
leucine-rich repeat 484..510 CDD:275381
leucine-rich repeat 61..86 CDD:275381 5/24 (21%)
AMN1 <69..203 CDD:187754 34/133 (26%)
leucine-rich repeat 87..112 CDD:275381 8/24 (33%)
leucine-rich repeat 113..136 CDD:275381 6/22 (27%)
leucine-rich repeat 137..162 CDD:275381 5/24 (21%)
leucine-rich repeat 163..189 CDD:275381 8/25 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1282076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.