DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and CG44006

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001262002.1 Gene:CG44006 / 14462878 FlyBaseID:FBgn0264748 Length:374 Species:Drosophila melanogaster


Alignment Length:253 Identity:49/253 - (19%)
Similarity:92/253 - (36%) Gaps:75/253 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 RRSLKDLVLGVPALTSLNLSGCFNVADM-----NLGHAFSVD--------------LPNLKTLDL 268
            :|::.||.:.|..|..:.|....:...:     .||.||:..              ...|..:.:
  Fly     4 QRTIYDLPIEVLDLIFVELQSLVDKVQLAQVHEKLGKAFAYHSRSAFKKLSPFFGVTQELWLVIV 68

  Fly   269 SLC---------KQI-----TDTSLGRIAQHLRNLETLEL----GGCCNITNTGL----LLIAWG 311
            |||         :||     :|..:..|.||..||:::.:    ..|..:.:..|    ||::..
  Fly    69 SLCGSTVEEFSSRQIWNTPWSDILVESIEQHCTNLKSVRIDVFENNCDGVRSFLLKMSKLLVSAE 133

  Fly   312 L-------KKLKHLNLRSCWHISDQGIGHLAGFSRETAEGNLQLEYLGLQDCQRLSDEALGH--- 366
            |       |||            ...:..:|..::....||:..:...:|....|.:..:.:   
  Fly   134 LTIFTKDPKKL------------FDSVAEMANVTQLALRGNITEDVCQIQKLTALEELVIDYNKS 186

  Fly   367 -----------IAQGLTSLKSINLSFCVSVTDSGLKHLARMPKLEQLNLRSCDNISDI 413
                       |...||:|:|:.:. .:::..|...|....||||.|.:..|:.|:::
  Fly   187 FNPFLPLNLLEICTPLTNLRSLTVR-NITIIPSEQPHPLIWPKLEDLKINDCEIITEL 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689
AMN1 <226..>334 CDD:187754 29/155 (19%)
leucine-rich repeat 236..256 CDD:275381 4/24 (17%)
leucine-rich repeat 263..288 CDD:275381 10/38 (26%)
leucine-rich repeat 289..314 CDD:275381 6/39 (15%)
leucine-rich repeat 315..347 CDD:275381 4/31 (13%)
AMN1 347..524 CDD:187754 16/81 (20%)
leucine-rich repeat 348..373 CDD:275381 4/38 (11%)
leucine-rich repeat 374..398 CDD:275381 4/23 (17%)
leucine-rich repeat 399..424 CDD:275381 5/15 (33%)
leucine-rich repeat 425..450 CDD:275381
leucine-rich repeat 451..475 CDD:275381
leucine-rich repeat 476..501 CDD:275381
CG44006NP_001262002.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.