DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and AgaP_AGAP011911

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:XP_320618.4 Gene:AgaP_AGAP011911 / 1280753 VectorBaseID:AGAP011911 Length:517 Species:Anopheles gambiae


Alignment Length:478 Identity:107/478 - (22%)
Similarity:159/478 - (33%) Gaps:167/478 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 THISNLFPELLEQIFEHLPVRDLGRAAQVCTAWRDAAYAKSVWKGV---EAKLHLKR-------- 200
            |..|||...:||:||.||.:::...|:..|:.|..|.|...||...   :|.|...|        
Mosquito    49 TQWSNLPDHILERIFSHLTIKERYYASLTCSGWYRAFYLPHVWSNFLVEDATLGRMRYNYYSGWQ 113

  Fly   201 ---SSPSLFNCLVK-----RGI------------KKVQILSLRRSLKDLVLGVP--------ALT 237
               ....|.:||:.     ||:            :.:.::|..........|.|        .:.
Mosquito   114 PVLDHARLQSCLLSVGHLIRGLDFRPQVSFNNMFQFMSLISWAMEQNARTAGCPREWVGCGSRIR 178

  Fly   238 SLN-LSGCFNVADMNLGHAFSVDLPNLKTLD-----------LSLC------KQITDTSLGRI-A 283
            ||| |..|      |:  |.|.|..::|...           |.||      ..:.|..|.|. |
Mosquito   179 SLNYLFPC------NM--AMSEDPESIKLFGTGGQLLAALKRLMLCLTNLHSLSLVDLFLERYEA 235

  Fly   284 QHLRNLETLELGGCC---------NITNTGLLLIAWGLKKLKHLNLR----SCWHISDQGIGHLA 335
            .||.: |.||  .||         |:||....::..||    .|||:    |..:|.|..:..||
Mosquito   236 NHLLD-EVLE--SCCLVLRRLCLVNVTNVHCPIMHIGL----FLNLQVLVVSPQNIDDDVLMLLA 293

  Fly   336 GFSRETAEGNLQLEY----LGLQDCQRLSDEALGHIAQGLTSLK----SINLSFCVSVTDSGL-- 390
            . |:......||..|    |.:..|.          |:...:::    .:.:..||..|.:.:  
Mosquito   294 D-SKVKHLTLLQNRYTPPALAISPCS----------AKAWLTVRRDNPKLRVHLCVESTTNAVIL 347

  Fly   391 --------KHLARMPKL-----------------------EQLNLRSCDNISDIG---------M 415
                    ..:.:.||.                       |||...:.:.:.| |         :
Mosquito   348 LQPEAPVASMIYQTPKTMITSDQLVAAVDAYKYTLTVYGHEQLPATTAEAVGD-GEFQERPDSLL 411

  Fly   416 AYLTEGGSGINSLDVSFCDKISDQALTHIAQGLYRLRSLSLNQCQI------------TD--HGM 466
            ..|.....|:|:|.|..|  ||...:..||.....||.|.:|:.|:            ||  :|.
Mosquito   412 LLLARSCPGLNALMVREC--ISTATILLIATSAQNLRHLYINRAQVRLGCDWPRSPDWTDEFYGW 474

  Fly   467 LKIAKALHELENLNIGQCSRITD 489
            |:...|..|.....:   |||.|
Mosquito   475 LQSTAASIEATEQEV---SRILD 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689 15/40 (38%)
AMN1 <226..>334 CDD:187754 37/147 (25%)
leucine-rich repeat 236..256 CDD:275381 6/20 (30%)
leucine-rich repeat 263..288 CDD:275381 10/42 (24%)
leucine-rich repeat 289..314 CDD:275381 10/33 (30%)
leucine-rich repeat 315..347 CDD:275381 9/35 (26%)
AMN1 347..524 CDD:187754 40/207 (19%)
leucine-rich repeat 348..373 CDD:275381 4/28 (14%)
leucine-rich repeat 374..398 CDD:275381 3/37 (8%)
leucine-rich repeat 399..424 CDD:275381 6/56 (11%)
leucine-rich repeat 425..450 CDD:275381 8/24 (33%)
leucine-rich repeat 451..475 CDD:275381 10/37 (27%)
leucine-rich repeat 476..501 CDD:275381 4/14 (29%)
AgaP_AGAP011911XP_320618.4 F-box-like 51..94 CDD:289689 16/42 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.