DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and CG43064

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001246726.1 Gene:CG43064 / 12798207 FlyBaseID:FBgn0262366 Length:481 Species:Drosophila melanogaster


Alignment Length:552 Identity:117/552 - (21%)
Similarity:191/552 - (34%) Gaps:162/552 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 SGSNGAATSGGAAIGG---AGAGGAPSWAMDELYQQTELPGLTRT----GATTTHHH--LLRFTP 83
            |....|.|:.|..|.|   :..|||..  .:...:|..:..|.|:    |.:|||..  :.....
  Fly     9 SAITNATTTEGNRISGTKRSNDGGAGE--QESRPKQRTIAQLDRSTCSAGPSTTHPSTTIFALNT 71

  Fly    84 YA-------------LHHRPPHHQLQTLPPALYLQHAAAAAAAAAAAAAHAQHHHHHHHHLPHRP 135
            |.             |:....:|||:.|..|  |||.......:...:..........:.:....
  Fly    72 YCWDMILSYLSLSEQLYLATSNHQLKMLFEA--LQHRYKIIGESDIGSIGEMELQKLLYIVGEHV 134

  Fly   136 ASPESPPPVEGTHISNLFPELLEQIFEHLPVRDLGRAAQVCTAWRDAAYAKSVWKGVEAKLHLKR 200
            .|.|||......|..:|:           .:||      .|...|                ||| 
  Fly   135 ISYESPLDPHSGHDQHLW-----------ILRD------YCPNLR----------------HLK- 165

  Fly   201 SSPSLFNCLVKRGIKKVQILSLRRSLKDLVLGVPALTSLNLSGCFNVADMNLGHAFSV---DLPN 262
                               :|.||...:.:|.:.:||||:.|  .:..|..|...|.:   |||:
  Fly   166 -------------------MSFRRPRWNPLLKLKSLTSLHAS--LHFTDEGLYKDFIISLSDLPH 209

  Fly   263 LKTLDLSLCKQITDTSLGRIAQHLRNLETLELGGCCNITNTGLLLIAWGLKKLKHLNLRSCWHIS 327
            ||.|.|.......|.     .:.|..||.||:|.......:.|......:|||.|||:       
  Fly   210 LKKLKLEATSYTGDG-----LRALDKLEYLEIGNQRGFDASILASCCMTMKKLCHLNM------- 262

  Fly   328 DQGIGHLAGFSRETAEGNLQLEYLGLQDCQRLSDEALGHIAQGLTSLKSINLSFCVSVTDSGLKH 392
                      ...||  ||:.|...:             |.:...:|:|  |:|.:.:.:..:.:
  Fly   263 ----------GENTA--NLEAEDFRV-------------IVRRGKNLES--LAFSLILLEGNVPY 300

  Fly   393 --LARMPKLEQLNLRSCDNISDIGMAY----LTEGGSGINSL----------------DVSFCDK 435
              :.::|||:.|.|...|| ..|..::    :.:.|:.:.||                ::|...:
  Fly   301 DTVHQLPKLKHLQLWYRDN-KFISKSFIEKLIQKPGTPLESLILMGNTLKLEEVDAICEISSLRE 364

  Fly   436 ISDQALTHIAQGLYRLRSLSLNQCQITDHGMLKIAKALHELENLNIGQCSRITDKGLQTLAEDLT 500
            :.....|..|:...||:.|     :|.|..||.::.  .||..| :.:|:.:....:: .|.::|
  Fly   365 LFVSCKTDAARSFLRLKHL-----EILDVKMLYVSN--DELLAL-LEECALLNVLSVR-FAREIT 420

  Fly   501 ---NLKTIDLYGCTQ----LSSKGIDIIMKLP 525
               .||.:.||...:    |....:|..:.||
  Fly   421 FEFVLKALSLYSHRKIKIYLHESSVDWSLNLP 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689 5/40 (13%)
AMN1 <226..>334 CDD:187754 30/110 (27%)
leucine-rich repeat 236..256 CDD:275381 7/19 (37%)
leucine-rich repeat 263..288 CDD:275381 6/24 (25%)
leucine-rich repeat 289..314 CDD:275381 6/24 (25%)
leucine-rich repeat 315..347 CDD:275381 7/31 (23%)
AMN1 347..524 CDD:187754 39/205 (19%)
leucine-rich repeat 348..373 CDD:275381 2/24 (8%)
leucine-rich repeat 374..398 CDD:275381 4/25 (16%)
leucine-rich repeat 399..424 CDD:275381 7/28 (25%)
leucine-rich repeat 425..450 CDD:275381 5/40 (13%)
leucine-rich repeat 451..475 CDD:275381 6/23 (26%)
leucine-rich repeat 476..501 CDD:275381 5/27 (19%)
CG43064NP_001246726.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.