| Sequence 1: | NP_001261138.1 | Gene: | Ppa / 37602 | FlyBaseID: | FBgn0020257 | Length: | 562 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_318863.4 | Gene: | AgaP_AGAP009775 / 1279182 | VectorBaseID: | AGAP009775 | Length: | 547 | Species: | Anopheles gambiae |
| Alignment Length: | 331 | Identity: | 76/331 - (22%) |
|---|---|---|---|
| Similarity: | 133/331 - (40%) | Gaps: | 87/331 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 261 PNLKTLDLSLCKQITDTSLGRIAQHLRNLETLELGGCCNITNTGLLLIAWGLKKLKHLNLRSCWH 325
Fly 326 ISDQGIGHLAGFSRETAEGNLQLEYLGLQDCQRLSDEALGHIAQG----LTSLKSINLSFCVSVT 386
Fly 387 DSGLK---HLARMPKLEQ---------------------LNLRSCDNISDIG------MAYLTEG 421
Fly 422 GSGINSLDVSFCDKISDQALTHIAQGLYRLRSLSLNQCQITDHGMLKIAKALHELENLNIGQCSR 486
Fly 487 ITDKGLQTLA--------------------EDLTNLKTIDLYGCTQLS----SKGIDIIMKLPKL 527
Fly 528 QKLNLG 533 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Ppa | NP_001261138.1 | F-box-like | 149..190 | CDD:289689 | |
| AMN1 | <226..>334 | CDD:187754 | 18/72 (25%) | ||
| leucine-rich repeat | 236..256 | CDD:275381 | |||
| leucine-rich repeat | 263..288 | CDD:275381 | 4/24 (17%) | ||
| leucine-rich repeat | 289..314 | CDD:275381 | 8/24 (33%) | ||
| leucine-rich repeat | 315..347 | CDD:275381 | 7/31 (23%) | ||
| AMN1 | 347..524 | CDD:187754 | 54/234 (23%) | ||
| leucine-rich repeat | 348..373 | CDD:275381 | 8/28 (29%) | ||
| leucine-rich repeat | 374..398 | CDD:275381 | 8/26 (31%) | ||
| leucine-rich repeat | 399..424 | CDD:275381 | 9/51 (18%) | ||
| leucine-rich repeat | 425..450 | CDD:275381 | 7/24 (29%) | ||
| leucine-rich repeat | 451..475 | CDD:275381 | 7/23 (30%) | ||
| leucine-rich repeat | 476..501 | CDD:275381 | 6/44 (14%) | ||
| AgaP_AGAP009775 | XP_318863.4 | LRR_8 | 88..148 | CDD:290566 | 18/76 (24%) |
| leucine-rich repeat | 90..109 | CDD:275380 | 5/20 (25%) | ||
| LRR_RI | 114..316 | CDD:238064 | 52/226 (23%) | ||
| leucine-rich repeat | 114..137 | CDD:275380 | 7/28 (25%) | ||
| LRR_8 | 137..196 | CDD:290566 | 17/68 (25%) | ||
| leucine-rich repeat | 138..161 | CDD:275380 | 8/31 (26%) | ||
| leucine-rich repeat | 162..185 | CDD:275380 | 7/23 (30%) | ||
| leucine-rich repeat | 186..233 | CDD:275380 | 6/47 (13%) | ||
| LRR_8 | 210..268 | CDD:290566 | 20/65 (31%) | ||
| leucine-rich repeat | 210..230 | CDD:275380 | 5/20 (25%) | ||
| leucine-rich repeat | 234..257 | CDD:275380 | 9/24 (38%) | ||
| LRR_RI | 236..>413 | CDD:238064 | 32/138 (23%) | ||
| leucine-rich repeat | 258..281 | CDD:275380 | 6/23 (26%) | ||
| LRR_8 | 280..338 | CDD:290566 | 11/58 (19%) | ||
| leucine-rich repeat | 282..305 | CDD:275380 | 5/23 (22%) | ||
| leucine-rich repeat | 306..329 | CDD:275380 | 1/22 (5%) | ||
| leucine-rich repeat | 330..377 | CDD:275380 | 9/36 (25%) | ||
| TPKR_C2 | 434..480 | CDD:301599 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||