DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and AgaP_AGAP000471

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:XP_003437004.1 Gene:AgaP_AGAP000471 / 1271769 VectorBaseID:AGAP000471 Length:574 Species:Anopheles gambiae


Alignment Length:414 Identity:102/414 - (24%)
Similarity:148/414 - (35%) Gaps:136/414 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 HAAAAAAAAAAAAAHAQHHHHHHHHLPHRPASPESPPPVE-------------GTHISNL--FP- 154
            |.|.|...|.|:||                ||| :|||||             ||:..||  .| 
Mosquito   199 HEARAKFQAVASAA----------------ASP-TPPPVEATAALELIGKAAGGTNQPNLTDMPY 246

  Fly   155 ELLEQIFEHLPVRDLGRAAQVCTAWRDAAYAKSVWKGVEAKLHLKRSSPSLFNCLVKR--GIKKV 217
            |:|..|..||....|....:||....:......:::.|..:.:..|........|..|  |||| 
Mosquito   247 EVLYHILSHLDWFALADVEKVCVRCAEVVADARLYREVNLRPYWDRVDSHFLLWLSNRCTGIKK- 310

  Fly   218 QILSLRRSLKDLVLGVPALTSLNLSGC-----FNVADMNL-------------------GHAFSV 258
                                 |:||||     ||:.|:.:                   .||.|.
Mosquito   311 ---------------------LDLSGCGIVNEFNIIDLQMFFNRHGRTLTHLRLNCIGVQHAMSF 354

  Fly   259 DL---PNLKTL------------DLSLCKQITDTSLGRIAQHLRNLETLELGGCCNITNTGLLLI 308
            .|   |.|..|            .||:||::|...|.| ||            |.:.|   ||.:
Mosquito   355 VLLLCPELTELCMQNALLDNQRYQLSVCKRLTVLDLSR-AQ------------CASET---LLAL 403

  Fly   309 AWGLKKLKHLNLRSCWHISDQGIGHLAGFSRETAEGNLQL---EYLG------LQDCQRLSDEAL 364
            ......|:||:|.||...|...|.|..| ....|..:|:|   ..||      ||.|.:|.:..|
Mosquito   404 LQQNPHLQHLSLASCDQSSLTDITHTIG-EHNRALLSLKLWKTHALGAHGLVPLQHCTKLQELDL 467

  Fly   365 GH-------------IAQGLTSLKSINLSFCVSVTDSGLKHLAR-MPKLEQLNLRSCDNISDIGM 415
            |:             :|.....|:.:.|.....:|::.|..:|| .|:|:.|:|.....:|...:
Mosquito   468 GYSNHEECAEGTLAQLAAACPDLRWLVLGGFRGITNNDLLAIARHCPRLQYLDLMCSVMLSGEAI 532

  Fly   416 AYLTEGGSGINSLDVSFCDKISDQ 439
            ..:..|...:..|::|:|:.|..:
Mosquito   533 NAIFIGCPALRLLELSYCNGIEQE 556

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689 11/43 (26%)
AMN1 <226..>334 CDD:187754 36/146 (25%)
leucine-rich repeat 236..256 CDD:275381 9/43 (21%)
leucine-rich repeat 263..288 CDD:275381 11/36 (31%)
leucine-rich repeat 289..314 CDD:275381 4/24 (17%)
leucine-rich repeat 315..347 CDD:275381 11/31 (35%)
AMN1 347..524 CDD:187754 26/116 (22%)
leucine-rich repeat 348..373 CDD:275381 10/46 (22%)
leucine-rich repeat 374..398 CDD:275381 6/24 (25%)
leucine-rich repeat 399..424 CDD:275381 5/24 (21%)
leucine-rich repeat 425..450 CDD:275381 4/15 (27%)
leucine-rich repeat 451..475 CDD:275381
leucine-rich repeat 476..501 CDD:275381
AgaP_AGAP000471XP_003437004.1 F-box 241..>274 CDD:295350 10/32 (31%)
leucine-rich repeat 308..347 CDD:275381 11/60 (18%)
leucine-rich repeat 362..384 CDD:275381 5/21 (24%)
AMN1 <378..553 CDD:187754 50/191 (26%)
leucine-rich repeat 385..409 CDD:275381 9/39 (23%)
leucine-rich repeat 410..436 CDD:275381 10/26 (38%)
leucine-rich repeat 437..461 CDD:275381 7/23 (30%)
leucine-rich repeat 462..489 CDD:275381 4/26 (15%)
leucine-rich repeat 490..515 CDD:275381 6/24 (25%)
leucine-rich repeat 516..541 CDD:275381 5/24 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.