DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and AgaP_AGAP011928

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:XP_552313.3 Gene:AgaP_AGAP011928 / 1269645 VectorBaseID:AGAP011928 Length:368 Species:Anopheles gambiae


Alignment Length:400 Identity:103/400 - (25%)
Similarity:169/400 - (42%) Gaps:99/400 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 TLPPALYLQHAAAAAAAAAAAAAHAQHHHHHHHHLPHRPASPESPPPVEGTHISNLFPEL----- 156
            |||   :|:|.:.||         ..:::.:|..     ...|:.|.:|...:||.|..|     
Mosquito    41 TLP---HLKHLSLAA---------CDYYNEYHFE-----RFIEAAPALESIDVSNCFINLYLSRR 88

  Fly   157 --------------LEQIFEHLPVRDLGRAAQVCTAWRDAAYAKSVWKGVEAKLHLKRSSPSLFN 207
                          |..|.|.:        ...|...|                ||..:...:.|
Mosquito    89 MTMISRVMRLRVLMLNHILEFV--------RTTCDRLR----------------HLFLAGTPIDN 129

  Fly   208 CLVKRGIKKVQILSLRRSLKDLVLGVPALTSLNLSGCFNVADMNLGHAFSVDLPNLKT----LDL 268
            ..: ||:..::.||||              ||.|..|..:.....|   .:||...:|    |||
Mosquito   130 VFL-RGLADIRALSLR--------------SLALMVCEKIPTNEPG---IIDLLRAQTGLTHLDL 176

  Fly   269 SLCKQITDTSLGRIAQHLRNLETLELGGCCNITNTGLLLIAWGLKKLKHLNLRSCWHISDQG-IG 332
            |....:.|.:|.:|::.:..||||.|..|..||:.|:..|. .|.:|:|::|.:|..|:|.| :|
Mosquito   177 SKSLALNDYALIQISRSIPQLETLILNRCWMITDYGITAIK-SLVRLRHIDLTNCERITDAGLVG 240

  Fly   333 HLAGFSRETAEGNLQLEYLGLQDCQRLSDEALGHIAQGLTSLKSINLSFCVSVTDSGLKHLA-RM 396
            .|...:|.    |::..||||  ...:||.|       ||.||.|:|:..:.::|.|::.|| ..
Mosquito   241 GLFTHNRR----NVRKLYLGL--LTNMSDAA-------LTKLKEISLARLLQISDHGIERLALGC 292

  Fly   397 PKLEQLNLRSCDNISDIGMAYLTEGGSGINSLDVSFCDKISDQALTHIAQGLYRLRSLSLNQC-Q 460
            |.||.::...|..|:|..:..:|:....:.:|.:..|.:|:|:|:.||.:....||.|::..| .
Mosquito   293 PSLEVVDFSECRTITDRCIEIITKCEPRLTTLKLQNCTQITDKAIRHIVENCRVLRVLNIRGCIN 357

  Fly   461 ITDHGMLKIA 470
            |:.:...|::
Mosquito   358 ISSYAEKKLS 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689 9/59 (15%)
AMN1 <226..>334 CDD:187754 34/112 (30%)
leucine-rich repeat 236..256 CDD:275381 5/19 (26%)
leucine-rich repeat 263..288 CDD:275381 8/28 (29%)
leucine-rich repeat 289..314 CDD:275381 11/24 (46%)
leucine-rich repeat 315..347 CDD:275381 11/32 (34%)
AMN1 347..524 CDD:187754 37/125 (30%)
leucine-rich repeat 348..373 CDD:275381 8/24 (33%)
leucine-rich repeat 374..398 CDD:275381 8/24 (33%)
leucine-rich repeat 399..424 CDD:275381 6/24 (25%)
leucine-rich repeat 425..450 CDD:275381 7/24 (29%)
leucine-rich repeat 451..475 CDD:275381 6/20 (30%)
leucine-rich repeat 476..501 CDD:275381
AgaP_AGAP011928XP_552313.3 leucine-rich repeat 12..44 CDD:275381 3/5 (60%)
leucine-rich repeat 117..142 CDD:275381 6/41 (15%)
leucine-rich repeat 143..169 CDD:275381 9/42 (21%)
AMN1 161..355 CDD:187754 66/207 (32%)
leucine-rich repeat 171..196 CDD:275381 7/24 (29%)
leucine-rich repeat 197..221 CDD:275381 11/24 (46%)
leucine-rich repeat 222..249 CDD:275381 10/30 (33%)
leucine-rich repeat 269..294 CDD:275381 8/24 (33%)
leucine-rich repeat 295..320 CDD:275381 6/24 (25%)
leucine-rich repeat 321..346 CDD:275381 7/24 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.