DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and fbxl4

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:XP_031761765.1 Gene:fbxl4 / 100490265 XenbaseID:XB-GENE-961513 Length:622 Species:Xenopus tropicalis


Alignment Length:350 Identity:97/350 - (27%)
Similarity:144/350 - (41%) Gaps:64/350 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 ELLEQIFEHLPVRDLGRAAQVCTA-------------------WRD---------------AAYA 185
            ||::.|..||.:.||.|.||.|..                   |.:               ..:.
 Frog   287 ELIQFIISHLALPDLCRLAQTCKLMYQHCCDPLQYTHLSLQPYWTNVNDNSLEYLLPRCSLVQWL 351

  Fly   186 KSVWKGVEAKLHLKRSSPSLFNCLVK-RGIKKVQI-LSLRRSLKDLVLGV-----PALTSLNLSG 243
            ...|.|....:     |.|.|:.|:| .|.:.|:: |:....|.:..|.|     |.|..||||.
 Frog   352 NLSWTGNRGLI-----STSGFSRLLKVCGSE
LVRLELACGHFLNEACLEVIAEMCPNLQELNLSS 411

  Fly   244 CFNVADMNLGHAFSVDLPNLKTLDLSLCKQITDTSLGRIAQHLRNLETLELGGCCNITNTGLLLI 308
            |..:......|.  ..|..||.|.|...| |..|:|..|......::.|.||.|..|.:..|:..
 Frog   412 CDKLPPQAFSHI--CKLSGLKRLVLYRTK-IEQTALLSILNFCPEIQHLNLGSCVLIEDYDLVAS 473

  Fly   309 AWG--LKKLKHLNLRSCWHISDQGIGHLAGFSRETAEGNLQLEYLGLQDCQRL--SDEALGHIAQ 369
            ..|  .|||:.|:|..|.:|:::||.       |.|.|.|.||.|.|..|..|  |.....::|.
 Frog   474 VLGAKCKKLRSLDLWRCKNITERGIA-------ELASGCLLLEELDLGWCPTLQSSTGCFVNLAS 531

  Fly   370 GLTSLKSINLSFCVSVTDSGLKHLAR-MPKLEQLNLRSCDNISDIGMAYLTEGGSGINSLDVSFC 433
            .|.:|:.:.|:...||.||.::.||| ...|:||::.....:|...:..|.|....:..||||||
 Frog   532 KLPNLRKLFLTANRSVCDSDIEELARNCQHLQQLDILGTRMVSPAALCKLLECCKELFLLDVSFC 596

  Fly   434 DKISDQALTHIAQGLYRLRSLSLNQ 458
            .:|..:.:..:   :.|..|:|:.:
 Frog   597 SQIDSRVVQEL---VTRFPSVSIKK 618

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689 12/68 (18%)
AMN1 <226..>334 CDD:187754 37/114 (32%)
leucine-rich repeat 236..256 CDD:275381 7/19 (37%)
leucine-rich repeat 263..288 CDD:275381 9/24 (38%)
leucine-rich repeat 289..314 CDD:275381 7/26 (27%)
leucine-rich repeat 315..347 CDD:275381 10/31 (32%)
AMN1 347..524 CDD:187754 34/114 (30%)
leucine-rich repeat 348..373 CDD:275381 9/26 (35%)
leucine-rich repeat 374..398 CDD:275381 9/24 (38%)
leucine-rich repeat 399..424 CDD:275381 6/24 (25%)
leucine-rich repeat 425..450 CDD:275381 7/24 (29%)
leucine-rich repeat 451..475 CDD:275381 2/7 (29%)
leucine-rich repeat 476..501 CDD:275381
fbxl4XP_031761765.1 F-box-like 281..325 CDD:403981 11/37 (30%)
leucine-rich repeat 296..318 CDD:275381 7/21 (33%)
leucine-rich repeat 319..341 CDD:275381 1/21 (5%)
leucine-rich repeat 348..377 CDD:275381 8/33 (24%)
leucine-rich repeat 378..403 CDD:275381 5/24 (21%)
leucine-rich repeat 404..428 CDD:275381 8/25 (32%)
AMN1 427..606 CDD:187754 60/186 (32%)
leucine-rich repeat 429..453 CDD:275381 9/24 (38%)
leucine-rich repeat 454..481 CDD:275381 7/26 (27%)
leucine-rich repeat 482..507 CDD:275381 10/31 (32%)
leucine-rich repeat 508..535 CDD:275381 9/26 (35%)
leucine-rich repeat 536..561 CDD:275381 9/24 (38%)
leucine-rich repeat 562..587 CDD:275381 6/24 (25%)
leucine-rich repeat 588..613 CDD:275381 8/27 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.