DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RYBP and yaf2

DIOPT Version :9

Sequence 1:NP_001286742.1 Gene:RYBP / 37601 FlyBaseID:FBgn0034763 Length:150 Species:Drosophila melanogaster
Sequence 2:XP_017210591.1 Gene:yaf2 / 692296 ZFINID:ZDB-GENE-041210-115 Length:184 Species:Danio rerio


Alignment Length:148 Identity:75/148 - (50%)
Similarity:93/148 - (62%) Gaps:14/148 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KRQAK-VIEENFWDCSVCTYRNSAEAFKCRMCDVRKGTSTRKPRLNSALVAQQAATLPGASVNMP 75
            ||||| ..::.:|||||||::|:||||||.||||||||||||||..|.||:|| .|...||..:|
Zfish    13 KRQAKPSSDDGYWDCSVCTFKNTAEAFKCMMCDVRKGTSTRKPRPVSQLVSQQ-VTQQFASATLP 76

  Fly    76 NGKSASGSRHGSGHDRQ------RHKRYPARLKNVDRSTAQTREVTVNSVTVFITEY--KAKPVS 132
            . |..........::|:      .||:...||||||||:||..||||..:||.||:|  |.||.|
Zfish    77 K-KEKKEKTEKDKNEREPTLKKNNHKKMRPRLKNVDRSSAQHLEVTVGDLTVIITDYKEKTKPSS 140

  Fly   133 SRRESSEQSFSESNDSRS 150
            |   ||..:.|..:.|:|
Zfish   141 S---SSSSATSADHHSQS 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RYBPNP_001286742.1 zf-RanBP 20..43 CDD:279035 15/22 (68%)
RanBP2-type Zn finger 23..42 CDD:275377 14/18 (78%)
yaf2XP_017210591.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573892
Domainoid 1 1.000 43 1.000 Domainoid score I12372
eggNOG 1 0.900 - - E1_KOG4477
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4203
Inparanoid 1 1.050 145 1.000 Inparanoid score I4413
OMA 1 1.010 - - QHG49670
OrthoDB 1 1.010 - - D1634090at2759
OrthoFinder 1 1.000 - - FOG0003518
OrthoInspector 1 1.000 - - oto41563
orthoMCL 1 0.900 - - OOG6_108317
Panther 1 1.100 - - O PTHR12920
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3403
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.770

Return to query results.
Submit another query.