DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RYBP and Yaf2

DIOPT Version :9

Sequence 1:NP_001286742.1 Gene:RYBP / 37601 FlyBaseID:FBgn0034763 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_001128343.1 Gene:Yaf2 / 690262 RGDID:1582851 Length:180 Species:Rattus norvegicus


Alignment Length:157 Identity:75/157 - (47%)
Similarity:91/157 - (57%) Gaps:9/157 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDKKSSPVRRQKRQAKVIEENFWDCSVCTYRNSAEAFKCRMCDVRKGTSTRKPRLNSALVAQQAA 65
            |..|.||.|.:::.....:|.:|||||||:|||||||||.||||||||||||||..|.|||||..
  Rat     1 MGDKKSPTRPKRQPKPASDEGYWDCSVCTFRNSAEAFKCMMCDVRKGTSTRKPRPVSQLVAQQVT 65

  Fly    66 ---TLPGASVNMPNGK-SASGSRHGSGHDRQRHKRYPARLKNVDRSTAQTREVTVNSVTVFITEY 126
               ..|..|......| ....|...:...:..|||...||||||||:||..||||..:||.||::
  Rat    66 QQFVPPTQSKKEKKDKVEKDKSEKEAASKKNCHKRTRPRLKNVDRSSAQHLEVTVGDLTVIITDF 130

  Fly   127 KAK----PVSSRRESSEQSFSE-SNDS 148
            |.|    |.|....:.:.|.|. |:|:
  Rat   131 KEKAKSAPASGAAAADQHSQSSCSSDT 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RYBPNP_001286742.1 zf-RanBP 20..43 CDD:279035 18/22 (82%)
RanBP2-type Zn finger 23..42 CDD:275377 16/18 (89%)
Yaf2NP_001128343.1 zf-RanBP 20..43 CDD:395516 18/22 (82%)
RanBP2-type Zn finger 23..42 CDD:275376 16/18 (89%)
YAF2_RYBP 102..133 CDD:407339 19/30 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334684
Domainoid 1 1.000 51 1.000 Domainoid score I11291
eggNOG 1 0.900 - - E1_KOG4477
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4203
Inparanoid 1 1.050 123 1.000 Inparanoid score I4634
OMA 1 1.010 - - QHG49670
OrthoDB 1 1.010 - - D1634090at2759
OrthoFinder 1 1.000 - - FOG0003518
OrthoInspector 1 1.000 - - otm46103
orthoMCL 1 0.900 - - OOG6_108317
Panther 1 1.100 - - O PTHR12920
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3403
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.