DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RYBP and rybp

DIOPT Version :9

Sequence 1:NP_001286742.1 Gene:RYBP / 37601 FlyBaseID:FBgn0034763 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_001016846.1 Gene:rybp / 549600 XenbaseID:XB-GENE-992066 Length:338 Species:Xenopus tropicalis


Alignment Length:306 Identity:80/306 - (26%)
Similarity:101/306 - (33%) Gaps:157/306 - (51%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDKKSSPVRRQKRQAK-VIEENFWDCSVCTYRNSAEAFKCRMCDVRKGTSTRKPRLNSALVAQQA 64
            |..|.||. |.||||| ..:|.:|||||||::||||||||.:|||||||||||||:||.|||||.
 Frog     3 MGDKKSPT-RPKRQAKPSADEGYWDCSVCTFKNSAEAFKCSICDVRKGTSTRKPRINSQLVAQQV 66

  Fly    65 ATLPGA----------SVNMPNGKSASGSR----------------------------------- 84
            |....:          .|..|..:.....:                                   
 Frog    67 AQQYASPPPPKKEKKEKVEKPEKERTDREKLEKEKPEKDKLDREKLDREKLDREKLDREKLDREK 131

  Fly    85 ---------------------------------------------------------HGSGHDRQ 92
                                                                     .....||:
 Frog   132 LDREKLDKEKLDRDKIDREKLDREKNDREKLEREKLDREKLDREKPEKEKPEKEKPEKEQKTDRE 196

  Fly    93 RHK------------------------------RYPA-----------------------RLKNV 104
            ||:                              |.|:                       ||||:
 Frog   197 RHEKDKEKTERDINSSVVKKTANKKTRPKPDILRNPSVDASIQSGNPNTKISNFNHTSRPRLKNI 261

  Fly   105 DRSTAQTREVTVNSVTVFITEYKAKPVSSRRESSEQSFSESNDSRS 150
            ||||||...|||.:|||.||::|.|..||...||..:.|..::.::
 Frog   262 DRSTAQQLAVTVGNVTVIITDFKEKTRSSSTSSSTVTSSAGSEQQN 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RYBPNP_001286742.1 zf-RanBP 20..43 CDD:279035 16/22 (73%)
RanBP2-type Zn finger 23..42 CDD:275377 15/18 (83%)
rybpNP_001016846.1 zf-RanBP 22..>45 CDD:366216 16/22 (73%)
RanBP2-type Zn finger 25..44 CDD:275376 15/18 (83%)
PTZ00266 <91..>174 CDD:173502 0/82 (0%)
YAF2_RYBP 255..286 CDD:375057 19/30 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11653
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 140 1.000 Inparanoid score I4392
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1634090at2759
OrthoFinder 1 1.000 - - FOG0003518
OrthoInspector 1 1.000 - - oto104931
Panther 1 1.100 - - LDO PTHR12920
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5806
SonicParanoid 1 1.000 - - X3403
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.100

Return to query results.
Submit another query.