DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RYBP and rybpb

DIOPT Version :9

Sequence 1:NP_001286742.1 Gene:RYBP / 37601 FlyBaseID:FBgn0034763 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_001012373.1 Gene:rybpb / 497613 ZFINID:ZDB-GENE-061103-96 Length:257 Species:Danio rerio


Alignment Length:235 Identity:80/235 - (34%)
Similarity:101/235 - (42%) Gaps:95/235 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDKKSSPVRRQKRQAKVIEEN-FWDCSVCTYRNSAEAFKCRMCDVRKGTSTRKPRLNSALVAQQA 64
            |..|.||. |.|||||...:| ||||||||:|||||||||.:|||||||||||||:||.|||||.
Zfish     1 MGDKKSPT-RPKRQAKPTADNGFWDCSVCTFRNSAEAFKCSICDVRKGTSTRKPRINSQLVAQQV 64

  Fly    65 A---------------------------------------------------------------- 65
            |                                                                
Zfish    65 AQQYATPPPPKKEKKEKPERPEKDRAEEERPDINPPDEHPVEQRDKDKSEKEQPEKEKKDREKEI 129

  Fly    66 -----TLPGASVNMP----------------NGKSASGSRHGSGHDRQRHKRYPARLKNVDRSTA 109
                 ..|.:..|.|                :|||.:.:::.       |...| :|||:|||||
Zfish   130 IPAITKKPNSKKNRPKSDIHQSPPSERNSIQSGKSTTKTKNS-------HNSRP-KLKNIDRSTA 186

  Fly   110 QTREVTVNSVTVFITEYKAKPVSSRRESSEQSFSESNDSR 149
            |...:||.:|||.||::|.|..:|...||..:.|.|::.:
Zfish   187 QQLAITVGNVTVIITDFKEKTRTSSTSSSTVTSSASSEQQ 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RYBPNP_001286742.1 zf-RanBP 20..43 CDD:279035 18/23 (78%)
RanBP2-type Zn finger 23..42 CDD:275377 16/18 (89%)
rybpbNP_001012373.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24 12/23 (52%)
ZnF_RBZ 21..43 CDD:197784 17/21 (81%)
RanBP2-type Zn finger 23..42 CDD:275377 16/18 (89%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 45..257 49/190 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573891
Domainoid 1 1.000 51 1.000 Domainoid score I11582
eggNOG 1 0.900 - - E1_KOG4477
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 145 1.000 Inparanoid score I4413
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1634090at2759
OrthoFinder 1 1.000 - - FOG0003518
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12920
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5806
SonicParanoid 1 1.000 - - X3403
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.890

Return to query results.
Submit another query.