Sequence 1: | NP_001286742.1 | Gene: | RYBP / 37601 | FlyBaseID: | FBgn0034763 | Length: | 150 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001012373.1 | Gene: | rybpb / 497613 | ZFINID: | ZDB-GENE-061103-96 | Length: | 257 | Species: | Danio rerio |
Alignment Length: | 235 | Identity: | 80/235 - (34%) |
---|---|---|---|
Similarity: | 101/235 - (42%) | Gaps: | 95/235 - (40%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MDKKSSPVRRQKRQAKVIEEN-FWDCSVCTYRNSAEAFKCRMCDVRKGTSTRKPRLNSALVAQQA 64
Fly 65 A---------------------------------------------------------------- 65
Fly 66 -----TLPGASVNMP----------------NGKSASGSRHGSGHDRQRHKRYPARLKNVDRSTA 109
Fly 110 QTREVTVNSVTVFITEYKAKPVSSRRESSEQSFSESNDSR 149 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RYBP | NP_001286742.1 | zf-RanBP | 20..43 | CDD:279035 | 18/23 (78%) |
RanBP2-type Zn finger | 23..42 | CDD:275377 | 16/18 (89%) | ||
rybpb | NP_001012373.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..24 | 12/23 (52%) | |
ZnF_RBZ | 21..43 | CDD:197784 | 17/21 (81%) | ||
RanBP2-type Zn finger | 23..42 | CDD:275377 | 16/18 (89%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 45..257 | 49/190 (26%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170573891 | |
Domainoid | 1 | 1.000 | 51 | 1.000 | Domainoid score | I11582 |
eggNOG | 1 | 0.900 | - | - | E1_KOG4477 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 145 | 1.000 | Inparanoid score | I4413 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1634090at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0003518 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | LDO | PTHR12920 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R5806 |
SonicParanoid | 1 | 1.000 | - | - | X3403 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
11 | 10.890 |