DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RYBP and yaf2

DIOPT Version :9

Sequence 1:NP_001286742.1 Gene:RYBP / 37601 FlyBaseID:FBgn0034763 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_988897.1 Gene:yaf2 / 394492 XenbaseID:XB-GENE-949941 Length:180 Species:Xenopus tropicalis


Alignment Length:169 Identity:73/169 - (43%)
Similarity:93/169 - (55%) Gaps:20/169 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDKKSSPVRRQKRQAKVIEENFWDCSVCTYRNSAEAFKCRMCDVRKGTSTRKPRLNSALVAQQAA 65
            |..|.||.|.:::.....:|.:|||||||::||||||||.||||||||||||||..|.|||||..
 Frog     1 MGDKKSPTRPKRQPKPSSDEGYWDCSVCTFKNSAEAFKCLMCDVRKGTSTRKPRPVSQLVAQQVT 65

  Fly    66 TLPGASVNMPNGKSASGSRHGSGHD----RQRHKRYPARLKNVDRSTAQTREVTVNSVTVFITEY 126
            ......:.....|.....:..|..:    :..||:...||||||||:||..||||..:||.||::
 Frog    66 QQFVPPMQTKKEKKDKIEKEKSEKETMIKKNSHKKTRPRLKNVDRSSAQHLEVTVGDLTVIITDF 130

  Fly   127 KAK----PVSSR------------RESSEQSFSESNDSR 149
            |.|    |.||.            .|::|:..|.|:..|
 Frog   131 KEKTKSPPTSSATCADQHSQSGSGSENTERGISRSSSPR 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RYBPNP_001286742.1 zf-RanBP 20..43 CDD:279035 17/22 (77%)
RanBP2-type Zn finger 23..42 CDD:275377 15/18 (83%)
yaf2NP_988897.1 zf-RanBP 20..>43 CDD:366216 17/22 (77%)
RanBP2-type Zn finger 23..42 CDD:275376 15/18 (83%)
YAF2_RYBP 102..134 CDD:375057 19/31 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H4203
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1634090at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5806
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.