| Sequence 1: | NP_001286742.1 | Gene: | RYBP / 37601 | FlyBaseID: | FBgn0034763 | Length: | 150 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_036366.3 | Gene: | RYBP / 23429 | HGNCID: | 10480 | Length: | 228 | Species: | Homo sapiens |
| Alignment Length: | 209 | Identity: | 86/209 - (41%) |
|---|---|---|---|
| Similarity: | 103/209 - (49%) | Gaps: | 60/209 - (28%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1 MDKKSSPVRRQKRQAK-VIEENFWDCSVCTYRNSAEAFKCRMCDVRKGTSTRKPRLNSALVAQQA 64
Fly 65 A-------------------------------------------TLPGASV--NMPNGKSASGSR 84
Fly 85 HGSGHDRQRHKRYPARLKNVDRSTAQTREVTVNSVTVFITEYKAKPVSSRRES--------SEQ- 140
Fly 141 ----SFSESNDSRS 150 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| RYBP | NP_001286742.1 | zf-RanBP | 20..43 | CDD:279035 | 18/22 (82%) |
| RanBP2-type Zn finger | 23..42 | CDD:275377 | 16/18 (89%) | ||
| RYBP | NP_036366.3 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..21 | 10/18 (56%) | |
| zf-RanBP | 22..45 | CDD:395516 | 18/22 (82%) | ||
| RanBP2-type Zn finger | 25..44 | CDD:275376 | 16/18 (89%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 65..156 | 39/146 (27%) | |||
| Interaction with GABPB1 and FANK1. /evidence=ECO:0000269|PubMed:11953439, ECO:0000269|PubMed:27060496 | 143..226 | 6/10 (60%) | |||
| YAF2_RYBP | 145..176 | CDD:407339 | 5/8 (63%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 172..228 |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C165141018 | |
| Domainoid | 1 | 1.000 | 51 | 1.000 | Domainoid score | I11598 |
| eggNOG | 1 | 0.900 | - | - | E1_KOG4477 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 125 | 1.000 | Inparanoid score | I4714 |
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1634090at2759 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0003518 | |
| OrthoInspector | 1 | 1.000 | - | - | otm41962 | |
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | LDO | PTHR12920 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R5806 |
| SonicParanoid | 1 | 1.000 | - | - | X3403 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 1 | 0.960 | - | - | ||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 12 | 11.890 | |||||