DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RYBP and tag-294

DIOPT Version :9

Sequence 1:NP_001286742.1 Gene:RYBP / 37601 FlyBaseID:FBgn0034763 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_508967.1 Gene:tag-294 / 180842 WormBaseID:WBGene00016937 Length:430 Species:Caenorhabditis elegans


Alignment Length:146 Identity:38/146 - (26%)
Similarity:61/146 - (41%) Gaps:33/146 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RQKRQAKVIEENF----------------WDCSVCTYRNSAEAFKCRMCDVRKGTSTRKPRLNSA 58
            |::.:.|..||:|                |.|..||:.|.|.|::|.:|..|||||||:...|..
 Worm     4 RKRLKRKNSEEDFDADDGDDGMDNDDINKWACHSCTFMNRAAAYRCFVCGTRKGTSTRRSTCNDN 68

  Fly    59 LVAQQAATLPGASVNMPNGKSASGSRHGSGHDRQRHKRYPARLKNVDRSTAQ---TREVTVNSVT 120
            :|..|..........:...||.           :|.:|  :.||:..|..::   |:||.:....
 Worm    69 VVEMQKTITTMVQKQVEKEKSL-----------KRKER--SLLKSATRELSEGVSTKEVKIEEPD 120

  Fly   121 VFITEYKAKPVSSRRE 136
            : .:|....||..::|
 Worm   121 I-ASEKPRTPVPEKQE 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RYBPNP_001286742.1 zf-RanBP 20..43 CDD:279035 10/38 (26%)
RanBP2-type Zn finger 23..42 CDD:275377 8/18 (44%)
tag-294NP_508967.1 ZnF_RBZ 31..55 CDD:197784 9/23 (39%)
RanBP2-type Zn finger 33..52 CDD:275376 8/18 (44%)
LYRIC 92..>288 CDD:374019 12/47 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156240
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4477
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003518
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12920
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.890

Return to query results.
Submit another query.