DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30269 and LITAF

DIOPT Version :9

Sequence 1:NP_001303360.1 Gene:CG30269 / 37600 FlyBaseID:FBgn0050269 Length:144 Species:Drosophila melanogaster
Sequence 2:XP_011521056.1 Gene:LITAF / 9516 HGNCID:16841 Length:191 Species:Homo sapiens


Alignment Length:146 Identity:44/146 - (30%)
Similarity:67/146 - (45%) Gaps:17/146 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDSVYPAAPLEAPKGSVELQATPEQQHLLPPAPPSYDQATTTPAETTGPAPVPASTSTTQHTVVV 65
            ::|.||..|...|..:..|...|:.:.:   .||||         .|.|||:|.:...|..||.|
Human    59 VNSYYPTPPAPMPGPTTGLVTGPDGKGM---NPPSY---------YTQPAPIPNNNPITVQTVYV 111

  Fly    66 VPGSPYGPEPMDVQCPYCHNYARTRVSFKPNSRTHLIALILCLFQLYC---CVCLPYCISSCMNT 127
            .....:...|:.:.||.|:....:::|:...:.|.|....|||  |.|   |..:|:|:.:..:.
Human   112 QHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCL--LGCIAGCCFIPFCVDALQDV 174

  Fly   128 NHYCGMCDRYLGTYDR 143
            :|||..|...||||.|
Human   175 DHYCPNCRALLGTYKR 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30269NP_001303360.1 REC114-like <34..111 CDD:291822 22/76 (29%)
zf-LITAF-like 74..142 CDD:287559 22/70 (31%)
LITAFXP_011521056.1 zf-LITAF-like 121..189 CDD:287559 22/69 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145601
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000358
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100529
Panther 1 1.100 - - O PTHR23292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X238
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.