DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30269 and si:dkeyp-75b4.8

DIOPT Version :9

Sequence 1:NP_001303360.1 Gene:CG30269 / 37600 FlyBaseID:FBgn0050269 Length:144 Species:Drosophila melanogaster
Sequence 2:XP_001336328.1 Gene:si:dkeyp-75b4.8 / 796031 ZFINID:ZDB-GENE-090313-395 Length:182 Species:Danio rerio


Alignment Length:169 Identity:42/169 - (24%)
Similarity:67/169 - (39%) Gaps:38/169 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DSVYPAAPLEAPKGSVELQATPEQQHLLPPA--PPSYDQATTTPAETTGPAPVP--------AST 56
            |.:.|..|      :::..|||      |||  .|:..|.......|.||.|.|        |:.
Zfish    26 DEIIPPPP------TIKTPATP------PPAYNEPNIPQGIPLNTCTGGPNPYPILNQPTQIAAV 78

  Fly    57 STTQHTVVVVPGSPYGPE---------------PMDVQCPYCHNYARTRVSFKPNSRTHLIALIL 106
            :..|...|....:|..|:               |..:.|.|||....|.|.:||...:.|:.:::
Zfish    79 TQQQQVFVQQSVNPVAPQVIVVQPQQSTTLDDTPASIVCRYCHQSIVTHVEYKPGVISWLMCVVI 143

  Fly   107 CLFQLYC-CVCLPYCISSCMNTNHYCGMCDRYLGTYDRK 144
            ......| |..:|:.:...::.:|.|.:|.|::|.|.||
Zfish   144 SFLGGICGCCVIPFFVRGFLDAHHSCPLCKRHIGIYTRK 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30269NP_001303360.1 REC114-like <34..111 CDD:291822 22/99 (22%)
zf-LITAF-like 74..142 CDD:287559 18/83 (22%)
si:dkeyp-75b4.8XP_001336328.1 zf-LITAF-like 111..179 CDD:287559 18/67 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578983
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000358
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100529
Panther 1 1.100 - - O PTHR23292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.