DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30269 and cdip1

DIOPT Version :9

Sequence 1:NP_001303360.1 Gene:CG30269 / 37600 FlyBaseID:FBgn0050269 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_001025631.1 Gene:cdip1 / 595019 XenbaseID:XB-GENE-5752851 Length:207 Species:Xenopus tropicalis


Alignment Length:205 Identity:50/205 - (24%)
Similarity:68/205 - (33%) Gaps:79/205 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PAAPL----------EAPKGSVELQATPEQQHLLPP--APPSYD--------------------- 37
            |:|||          |.|:.:...||.|    ..||  .||.||                     
 Frog    13 PSAPLLEEKQGLPRMEEPRAAPYPQAMP----FAPPDCGPPPYDANPGYIAPNPGFYPPPGPYAP 73

  Fly    38 --QATTTPAETTGP-----------------APVPASTS------TTQHTVVVVPGSPYGPEPMD 77
              ....||.:...|                 .|.|:|||      :|..||.|:.|..:...|:.
 Frog    74 MGYYPPTPGQFQPPYPSQYPSPGAQGTAVIVPPGPSSTSAATTVTSTTTTVTVLQGEIFQGSPVQ 138

  Fly    78 VQCPYCHNYARTRVSFKPNSRTHLIAL---ILCLF------QLYCCVCLPYCISSCMNTNHYCGM 133
            ..|..|.....|::|       |.|.|   :||.|      .|.||: :|..|:...:..|.|..
 Frog   139 TVCTNCQQPITTKIS-------HDIGLMNFLLCCFCCFVGCDLGCCL-IPCIINDLKDVTHSCPN 195

  Fly   134 CDRYLGTYDR 143
            |..::.||.|
 Frog   196 CKYHIYTYRR 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30269NP_001303360.1 REC114-like <34..111 CDD:291822 27/131 (21%)
zf-LITAF-like 74..142 CDD:287559 20/76 (26%)
cdip1NP_001025631.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..54 15/44 (34%)
zf-LITAF-like 135..204 CDD:402300 20/76 (26%)
Membrane-binding amphipathic helix. /evidence=ECO:0000305 161..183 7/22 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23292
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X238
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.