DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30269 and Litaf

DIOPT Version :9

Sequence 1:NP_001303360.1 Gene:CG30269 / 37600 FlyBaseID:FBgn0050269 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_064364.1 Gene:Litaf / 56722 MGIID:1929512 Length:161 Species:Mus musculus


Alignment Length:166 Identity:47/166 - (28%)
Similarity:69/166 - (41%) Gaps:38/166 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LEAPKGSVELQATPEQQHLLPPAPPSYDQAT-------TTPAETTGPA----------------- 50
            :.|| |..:..|.|.   ::|.|||:|::..       |.||...|||                 
Mouse     1 MSAP-GPYQAAAGPS---VVPTAPPTYEETVGVNSYYPTPPAPMPGPATGLITGPDGKGMNPPSY 61

  Fly    51 -----PVPASTSTTQHTVVVVPGSPYGPEPMDVQCPYCHNYARTRVSFKPNSRTHLIALILCLFQ 110
                 |||.:.:....||.|.....:...|:.:.||.|.....|::|:...:.|.|....|||  
Mouse    62 YTQPVPVPNANAIAVQTVYVQQPVSFYDRPVQMCCPSCSKMIVTQLSYNAGALTWLSCGSLCL-- 124

  Fly   111 LYC---CVCLPYCISSCMNTNHYCGMCDRYLGTYDR 143
            |.|   |..:|:|:.:..:.:|||..|...||||.|
Mouse   125 LGCVAGCCFIPFCVDALQDVDHYCPNCKALLGTYKR 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30269NP_001303360.1 REC114-like <34..111 CDD:291822 25/105 (24%)
zf-LITAF-like 74..142 CDD:287559 23/70 (33%)
LitafNP_064364.1 PPxY motif 20..23 2/2 (100%)
zf-LITAF-like 91..159 CDD:371158 23/69 (33%)
Membrane-binding amphipathic helix. /evidence=ECO:0000305 111..134 8/24 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835667
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000358
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100529
Panther 1 1.100 - - O PTHR23292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X238
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.800

Return to query results.
Submit another query.