DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30269 and si:ch211-202h22.8

DIOPT Version :9

Sequence 1:NP_001303360.1 Gene:CG30269 / 37600 FlyBaseID:FBgn0050269 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_001278864.1 Gene:si:ch211-202h22.8 / 559550 ZFINID:ZDB-GENE-090313-78 Length:137 Species:Danio rerio


Alignment Length:139 Identity:40/139 - (28%)
Similarity:59/139 - (42%) Gaps:8/139 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PAAPLEAPKGSVELQATPEQQHLLP-PAPPSYDQATTTPAETTGPAPVPASTSTTQHTVVVVPGS 69
            ||.|..:.....:.|.||......| |..|.:.:....||..:.||||    ..||  ||::|.|
Zfish     5 PALPPYSGPEVNQTQFTPYPVQYQPQPVYPPHPKDGFAPAVQSSPAPV----VVTQ--VVMMPPS 63

  Fly    70 PYGPEPMDVQCPYCHNYARTRVSFKPNSRTHLIALILCLFQLYCCVCLPYCISSCMNTNHYCGMC 134
             ....|...:||:|.....|...:.....|.||...|.:..::.|..:|:|:|:|.:..|.|..|
Zfish    64 -LSDVPGQTKCPHCQQQIITETRYVNGLLTWLICGGLGILLIWPCCLIPFCVSACKDVEHRCPNC 127

  Fly   135 DRYLGTYDR 143
            ...:..|.|
Zfish   128 KHVVFLYKR 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30269NP_001303360.1 REC114-like <34..111 CDD:291822 22/76 (29%)
zf-LITAF-like 74..142 CDD:287559 17/67 (25%)
si:ch211-202h22.8NP_001278864.1 zf-LITAF-like 68..135 CDD:287559 17/66 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578986
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I5124
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000358
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100529
Panther 1 1.100 - - O PTHR23292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X238
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.