DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30269 and si:ch211-202h22.9

DIOPT Version :9

Sequence 1:NP_001303360.1 Gene:CG30269 / 37600 FlyBaseID:FBgn0050269 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_001139042.1 Gene:si:ch211-202h22.9 / 559480 ZFINID:ZDB-GENE-030131-1143 Length:140 Species:Danio rerio


Alignment Length:145 Identity:43/145 - (29%)
Similarity:54/145 - (37%) Gaps:34/145 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YPA--APLEAPKGSVELQATPEQQHLLPPAPPSYDQATTTPAETTGPAPVPAS----TSTTQHTV 63
            ||.  ||...|.|.   ||.|.|       ||.|.     |..|:.|.|:|..    ||.|.   
Zfish    22 YPVQPAPYPPPAGP---QAAPYQ-------PPPYG-----PPYTSQPMPIPVQQMPLTSLTD--- 68

  Fly    64 VVVPGSPYGPEPMDVQCPYCHNYARTRVSFKPNSRTHLIALILCLFQLYCCVCLPYCISSCMNTN 128
              |||.        :.||:|.....|...........||...|.||..:.|.|:|:|:.:|.:..
Zfish    69 --VPGR--------ITCPHCLTEVITETEHVSGLMAWLICGTLALFVCWLCCCIPFCLDACKDVK 123

  Fly   129 HYCGMCDRYLGTYDR 143
            |.|..|...:..|.|
Zfish   124 HTCPNCRNIIRIYKR 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30269NP_001303360.1 REC114-like <34..111 CDD:291822 22/80 (28%)
zf-LITAF-like 74..142 CDD:287559 17/67 (25%)
si:ch211-202h22.9NP_001139042.1 zf-LITAF-like 70..137 CDD:287559 19/74 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578952
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I5124
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000358
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100529
Panther 1 1.100 - - O PTHR23292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X238
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.