DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30269 and cdip1

DIOPT Version :9

Sequence 1:NP_001303360.1 Gene:CG30269 / 37600 FlyBaseID:FBgn0050269 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_001092712.1 Gene:cdip1 / 557073 ZFINID:ZDB-GENE-070720-18 Length:213 Species:Danio rerio


Alignment Length:210 Identity:53/210 - (25%)
Similarity:69/210 - (32%) Gaps:83/210 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PAAPLEAPK--------GSVELQATPEQQHLLPP--APPSYDQATTTP----------------- 43
            |.|||...|        |:..:...|.|.|.|||  .||.| :||..|                 
Zfish    13 PNAPLLEEKNGQPLHSAGTAPVMTGPPQGHPLPPEYGPPPY-EATQQPGFVPPHVPGEGPIPKPM 76

  Fly    44 ------------------------AETTGPAP------------VPASTSTTQHTVVVVPGSPYG 72
                                    .|..||.|            .|...:||  ||.|:.|..:.
Zfish    77 HMPMPMPHPHGGYYPPLGHFPHTMGEYAGPGPSHFAPGHTATVLAPPGAATT--TVTVLQGEMFQ 139

  Fly    73 PEPMDVQCPYCHNYARTRVSFKPNSRTHLIAL---ILCLF------QLYCCVCLPYCISSCMNTN 128
            ..|:...||:|.....||:|       |.|.|   ::|:|      .|.||: :|..|....:..
Zfish   140 SAPVQTVCPHCQQPIITRIS-------HDIGLMNTLVCMFCFFVGCDLGCCL-IPCLIDDLKDVT 196

  Fly   129 HYCGMCDRYLGTYDR 143
            |.|..|..|:.||.|
Zfish   197 HTCPNCKGYIYTYKR 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30269NP_001303360.1 REC114-like <34..111 CDD:291822 28/138 (20%)
zf-LITAF-like 74..142 CDD:287559 22/76 (29%)
cdip1NP_001092712.1 zf-LITAF-like 142..210 CDD:287559 22/75 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578946
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X238
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.