DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG30269 and litaf

DIOPT Version :9

Sequence 1:	NP_001303360.1	Gene:	CG30269 / 37600	FlyBaseID:	FBgn0050269	Length:	144	Species:	Drosophila melanogaster
Sequence 2:	NP_001002184.1	Gene:	litaf / 431731	ZFINID:	ZDB-GENE-040704-23	Length:	163	Species:	Danio rerio

Alignment Length:	143	Identity:	39/143 - (27%)
Similarity:	54/143 - (37%)	Gaps:	30/143 - (20%)

- Green bases have known domain annotations that are detailed below.

  Fly    31 PAPPSYDQATTT----------PAE--TTGPAPVP-----------------ASTSTTQHTVVVV 66
            |.|||||:.:..          ||:  .:||.|.|                 .|......||.|.
Zfish    20 PPPPSYDEISGANPYYPAGPYPPADMKASGPPPYPTQEYNQMYPPTAQGQPVTSPVVAVQTVYVQ 84

  Fly    67 PGSPYGPEPMDVQCPYCHNYARTRVSFKPNSRTHLIALILCLFQ-LYCCVCLPYCISSCMNTNHY 130
            ||..:|..|:...||.|.....||:.:.......|....|.:|. :|.|..:|:||....:..|:
Zfish    85 PGLVFGNVPVQAHCPVCSQSVITRLEYSSGPLVWLSCAGLAVFGCIYGCCLIPFCIEDLKDVTHH 149

  Fly   131 CGMCDRYLGTYDR 143
            |..|...||.:.|
Zfish   150 CPNCSSVLGVHKR 162

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG30269	NP_001303360.1	REC114-like	<34..111	CDD:291822	26/106 (25%)
CG30269	NP_001303360.1	zf-LITAF-like	74..142	CDD:287559	19/68 (28%)
litaf	NP_001002184.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..23		1/2 (50%)
		PPxY motif. /evidence=ECO:0000250\|UniProtKB:Q99732	22..25		2/2 (100%)
		zf-LITAF-like	93..161	CDD:287559	19/67 (28%)
		Membrane-binding amphipathic helix. /evidence=ECO:0000305	116..136		5/19 (26%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C170578988
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000358
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	1	0.900	-	-		OOG6_100529
Panther	1	1.100	-	-	O	PTHR23292
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	1	1.000	-	-		X238
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	6	5.840