DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30269 and litaf

DIOPT Version :9

Sequence 1:NP_001303360.1 Gene:CG30269 / 37600 FlyBaseID:FBgn0050269 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_988970.1 Gene:litaf / 394567 XenbaseID:XB-GENE-1017030 Length:148 Species:Xenopus tropicalis


Alignment Length:134 Identity:40/134 - (29%)
Similarity:56/134 - (41%) Gaps:21/134 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LPPAPPSYDQAT------------TTPAETTGP----APVPASTSTTQHTVVVVPGSPYGPEPMD 77
            :|.|||||::||            ......:.|    .|||.....|..||.|.........|:.
 Frog    16 VPSAPPSYEEATFHHPPYPPLHQGMDAKNMSNPPYIVQPVPMQPPVTVQTVYVQQAMTLYDRPVQ 80

  Fly    78 VQCPYCHNYARTRVSFKPNSRTHLIALILCLFQLYC---CVCLPYCISSCMNTNHYCGMCDRYLG 139
            :.|..|::...||:.:...:...|....|||  |.|   |..:|:||.|..:.:|||..|...||
 Frog    81 MCCRSCNSMITTRLEYSSGALAWLSCGGLCL--LGCIGGCCLIPFCIDSLKDVDHYCPNCHALLG 143

  Fly   140 TYDR 143
            :|.|
 Frog   144 SYKR 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30269NP_001303360.1 REC114-like <34..111 CDD:291822 22/92 (24%)
zf-LITAF-like 74..142 CDD:287559 22/70 (31%)
litafNP_988970.1 PPxY motif. /evidence=ECO:0000250|UniProtKB:Q99732 20..23 2/2 (100%)
zf-LITAF-like 78..146 CDD:371158 22/69 (32%)
Membrane-binding amphipathic helix. /evidence=ECO:0000305 101..123 7/23 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000358
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X238
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.