DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30269 and CG13511

DIOPT Version :9

Sequence 1:NP_001303360.1 Gene:CG30269 / 37600 FlyBaseID:FBgn0050269 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_001246466.1 Gene:CG13511 / 37597 FlyBaseID:FBgn0034759 Length:122 Species:Drosophila melanogaster


Alignment Length:117 Identity:42/117 - (35%)
Similarity:57/117 - (48%) Gaps:26/117 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 GPAPVPASTS----TTQ--HTVVVV-----------PGS---PYGPEPMDVQCPYCHNYARTRVS 92
            |.||.||.|.    |||  :.|||.           ||:   ..|.:||.|:||.|.....|.::
  Fly     7 GRAPEPADTEMVTVTTQPNYGVVVTQIPVYTLNGVGPGAHPLAVGCKPMRVRCPSCRGEVTTSLA 71

  Fly    93 FKPNSRTHLIALILCLFQLYCC---VCLPYCISSCMNTNHYCGMCDRYLGTY 141
            ..|..:||:.||.|   .:.||   :||||.|:.|.:..|||..|..::|:|
  Fly    72 TSPTRKTHMCALTL---YICCCWPFICLPYFINYCKSVQHYCPNCGCHIGSY 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30269NP_001303360.1 REC114-like <34..111 CDD:291822 28/82 (34%)
zf-LITAF-like 74..142 CDD:287559 27/71 (38%)
CG13511NP_001246466.1 zf-LITAF-like 53..120 CDD:287559 26/69 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000358
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100529
Panther 1 1.100 - - P PTHR23292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X238
54.910

Return to query results.
Submit another query.