DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30269 and CG13510

DIOPT Version :9

Sequence 1:NP_001303360.1 Gene:CG30269 / 37600 FlyBaseID:FBgn0050269 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_001246465.1 Gene:CG13510 / 37596 FlyBaseID:FBgn0034758 Length:129 Species:Drosophila melanogaster


Alignment Length:144 Identity:59/144 - (40%)
Similarity:71/144 - (49%) Gaps:18/144 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDSVYPAAPLEAPKGSVELQATPEQQHLL--PPAPPSYDQATTTPAETTGPAPVPASTSTTQHTV 63
            |||..|      |..|.:...||.|.:..  |..||.|......|..:|    |...|:||.:.|
  Fly     1 MDSKQP------PPYSEQSGYTPAQTYQPGGPTQPPLYPPMPQPPQSST----VIIQTTTTSNLV 55

  Fly    64 VVVPGSPYGPEPMDVQCPYCHNYARTRVSFKPNSRTHLIALILCLFQLYCCVCLPYCISSCMNTN 128
                  |.|..|..::||.||....|.|...|:.|||..|||||||..:.|||||||:.||.|.|
  Fly    56 ------PIGSGPTRIRCPSCHAEVLTTVKSTPSGRTHCWALILCLFICWPCVCLPYCMDSCQNAN 114

  Fly   129 HYCGMCDRYLGTYD 142
            |||..|..|:|||:
  Fly   115 HYCPNCSAYIGTYE 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30269NP_001303360.1 REC114-like <34..111 CDD:291822 29/76 (38%)
zf-LITAF-like 74..142 CDD:287559 36/67 (54%)
CG13510NP_001246465.1 zf-LITAF-like 61..128 CDD:287559 36/66 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448954
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2DZV6
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I5124
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000358
OrthoInspector 1 1.000 - - otm14624
orthoMCL 1 0.900 - - OOG6_100529
Panther 1 1.100 - - P PTHR23292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X238
98.790

Return to query results.
Submit another query.