DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30269 and CG30196

DIOPT Version :9

Sequence 1:NP_001303360.1 Gene:CG30269 / 37600 FlyBaseID:FBgn0050269 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_726220.1 Gene:CG30196 / 37595 FlyBaseID:FBgn0050196 Length:147 Species:Drosophila melanogaster


Alignment Length:66 Identity:18/66 - (27%)
Similarity:28/66 - (42%) Gaps:4/66 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 EPMDVQCPYCHNYARTRVSFKPNSRTHLIALILCLFQLYCCVCLPYCISSCMNTNHYCGMCDRYL 138
            ||.:::||.|.....|.|.   :....::..|.|...:..| |.|.......:.||||..|..::
  Fly    28 EPQELECPACQQLQTTHVK---SEAVTVLQKIACSLNVLLC-CNPIRWKGRHDVNHYCSSCGCFI 88

  Fly   139 G 139
            |
  Fly    89 G 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30269NP_001303360.1 REC114-like <34..111 CDD:291822 9/36 (25%)
zf-LITAF-like 74..142 CDD:287559 18/66 (27%)
CG30196NP_726220.1 LITAF 29..90 CDD:197841 17/65 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23292
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.