powered by:
Protein Alignment CG30269 and CG30196
DIOPT Version :9
Sequence 1: | NP_001303360.1 |
Gene: | CG30269 / 37600 |
FlyBaseID: | FBgn0050269 |
Length: | 144 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_726220.1 |
Gene: | CG30196 / 37595 |
FlyBaseID: | FBgn0050196 |
Length: | 147 |
Species: | Drosophila melanogaster |
Alignment Length: | 66 |
Identity: | 18/66 - (27%) |
Similarity: | 28/66 - (42%) |
Gaps: | 4/66 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 74 EPMDVQCPYCHNYARTRVSFKPNSRTHLIALILCLFQLYCCVCLPYCISSCMNTNHYCGMCDRYL 138
||.:::||.|.....|.|. :....::..|.|...:..| |.|.......:.||||..|..::
Fly 28 EPQELECPACQQLQTTHVK---SEAVTVLQKIACSLNVLLC-CNPIRWKGRHDVNHYCSSCGCFI 88
Fly 139 G 139
|
Fly 89 G 89
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR23292 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.