DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30269 and F36G3.3

DIOPT Version :9

Sequence 1:NP_001303360.1 Gene:CG30269 / 37600 FlyBaseID:FBgn0050269 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_001024633.2 Gene:F36G3.3 / 3565543 WormBaseID:WBGene00009484 Length:148 Species:Caenorhabditis elegans


Alignment Length:152 Identity:40/152 - (26%)
Similarity:56/152 - (36%) Gaps:48/152 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PPA-----PPSY--DQATTTP-----AETTGP--------------------------APVPAST 56
            |||     ||:|  |.|.|.|     :..|.|                          .|:|.||
 Worm     6 PPAYDQIVPPAYNPDYAPTQPVYHPSSHVTAPPYHYHDNGGFENVVDVNSPVYTTLASGPMPTST 70

  Fly    57 STTQHTVVVVPGSPYGPEPMDVQCPYCHNYARTRVSFKPNSRTHLIALILCLFQLYCCVCLPYCI 121
                   :::...|:..:   :|||||.....||........|.:....|.||..:||..||:|:
 Worm    71 -------IIIRLEPHATK---LQCPYCRMDIVTRTKSVYGLLTWIFFAALFLFGCWCCCFLPFCL 125

  Fly   122 SSCMNTNHYCGMCDRYLGTYDR 143
            .||.:..|.|..|...:|.:.|
 Worm   126 RSCKDIIHTCPNCRAMIGVHRR 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30269NP_001303360.1 REC114-like <34..111 CDD:291822 24/109 (22%)
zf-LITAF-like 74..142 CDD:287559 22/67 (33%)
F36G3.3NP_001024633.2 zf-LITAF-like 80..146 CDD:371158 22/68 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158618
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000358
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100529
Panther 1 1.100 - - O PTHR23292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X238
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.800

Return to query results.
Submit another query.