DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30269 and Y87G2A.19

DIOPT Version :9

Sequence 1:NP_001303360.1 Gene:CG30269 / 37600 FlyBaseID:FBgn0050269 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_001021835.1 Gene:Y87G2A.19 / 3565150 WormBaseID:WBGene00044260 Length:110 Species:Caenorhabditis elegans


Alignment Length:98 Identity:24/98 - (24%)
Similarity:43/98 - (43%) Gaps:5/98 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 PVPASTSTTQHTVVVVPGSPY-GPEPMDVQCPYCHNYARTRVSFKPNSRTHLIALILCLFQLYCC 114
            |:|...|.:....::|....| ...|..:.||.|..:..|.:.|.....|::...|:.:|.....
 Worm     8 PIPIHRSASHTPSMLVNAKKYLSDRPQLLDCPRCKVHGETELRFVNGFFTYVSFFIILIFGFAIL 72

  Fly   115 ----VCLPYCISSCMNTNHYCGMCDRYLGTYDR 143
                :.:|:|:.:..:..|||..|..::|||.|
 Worm    73 PLFFLWVPFCVETFKDAEHYCPSCRAWIGTYRR 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30269NP_001303360.1 REC114-like <34..111 CDD:291822 14/60 (23%)
zf-LITAF-like 74..142 CDD:287559 17/71 (24%)
Y87G2A.19NP_001021835.1 LITAF 33..105 CDD:197841 18/71 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158611
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000358
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100529
Panther 1 1.100 - - O PTHR23292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.800

Return to query results.
Submit another query.